MOCS1 Antibody

Images

 
Western Blot: MOCS1 Antibody [NBP2-87812] - Host: Rabbit. Target Name: MOCS1. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MOCS1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MOCS1. Peptide sequence: QVATLWKGCRVPQTPPLAQQRLGSGSFQRHYTSRADSDANSKCLSPGSWA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MOCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MOCS1 Antibody

  • molybdenum cofactor synthesis 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32423
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP2-17320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33431
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt, Bv, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023002-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP, PLA
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
H00342184-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-113
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IP
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24716
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-231
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-24615
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85217
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MOCS1 Antibody (NBP2-87812) (0)

There are no publications for MOCS1 Antibody (NBP2-87812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOCS1 Antibody (NBP2-87812) (0)

There are no reviews for MOCS1 Antibody (NBP2-87812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOCS1 Antibody (NBP2-87812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MOCS1 Products

Array NBP2-87812

Bioinformatics Tool for MOCS1 Antibody (NBP2-87812)

Discover related pathways, diseases and genes to MOCS1 Antibody (NBP2-87812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOCS1 Antibody (NBP2-87812)

Discover more about diseases related to MOCS1 Antibody (NBP2-87812).
 

Pathways for MOCS1 Antibody (NBP2-87812)

View related products by pathway.

PTMs for MOCS1 Antibody (NBP2-87812)

Learn more about PTMs related to MOCS1 Antibody (NBP2-87812).

Blogs on MOCS1

There are no specific blogs for MOCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOCS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MOCS1