MMP-16/MT3-MMP Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MMP-16/MT3-MMP Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP16.
  
  

  Source: E. coli

  Amino Acid Sequence: TTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MMP16
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86721.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-16/MT3-MMP Recombinant Protein Antigen

• chromosome 8 open reading frame 57
• DKFZp761D112
• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.80
• matrix metallopeptidase 16 (membrane-inserted)
• matrix metalloproteinase 16 (membrane-inserted)
• matrix metalloproteinase-16
• Membrane-type matrix metalloproteinase 3
• Membrane-type-3 matrix metalloproteinase
• MMP16
• MMP-16
• MMPX2
• MMP-X2
• MT3MMP
• MT3-MMP
• MT3-MMPC8orf57
• MT-MMP 3
• MT-MMP2
• MTMMP3
• MT-MMP3
• Putative transmembrane protein C8orf57

Background

The matrix metalloproteinases (MMP) are a family of peptidase enzymes responsible for the degradation of extracellular matrix components, including collagen, gelatin, fibronectin, laminin and proteoglycan. Transcription of MMP genes is differentially activated by phorbol ester, lipopolysaccharide (LPS) or staphylococcal enterotoxin B (SEB). MMP catalysis requires both calcium and zinc. MMP-13 (also designated collagenase-3) is produced by breast carcinomas and degrades collagen types I, II and III. MMP-13 has wide substrate specificity, and its physiologic expression is limited to situations in which rapid and effective remodeling of collagenous ECM takes place, such as fetal bone development and adult bone remodeling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP16