MLL5 Recombinant Protein Antigen

Images

 
There are currently no images for MLL5 Recombinant Protein Antigen (NBP3-17395PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MLL5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLL5

Source: E.coli

Amino Acid Sequence: LASGHHTTSAQALHHPPHQGPPLFPSSAHPTVPPYPSQATHHTTLGPGPQHQPSGTGPHCPLPVTGPHLQPQGPNSIPTPTASGFCPHPGSVALPHGVQGPQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KMT2E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17395. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLL5 Recombinant Protein Antigen

  • EC 2.1.1.43
  • FLJ10078
  • HDCMC04P
  • histone-lysine N-methyltransferase MLL5
  • KMT2EFLJ14026
  • Lysine N-methyltransferase 2E
  • MGC70452
  • myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila)
  • Myeloid/lymphoid or mixed-lineage leukemia protein 5

Background

MLL5 is a divergent member of the Drosophila Trithorax related SET and PHD domain containing chromatin regulators that are involved in the regulation of transcriptional "memory" during differentiation. Human MLL5 is located on chromosome 7q22, that is frequently deleted in myeloid leukemias. Inactivation of the Mll5 gene in mice results in a reduction in the average representation of hematopoietic stem cells, and in functional impairment of long term hematopoietic repopulation potential under competitive conditions. Overexpression of the protein also inhibits cell cycle progression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-27147
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-558
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-89443
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-16473
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-56664
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
MAB66861
Species: Hu
Applications: ICC, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-31330
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for MLL5 Recombinant Protein Antigen (NBP3-17395PEP) (0)

There are no publications for MLL5 Recombinant Protein Antigen (NBP3-17395PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLL5 Recombinant Protein Antigen (NBP3-17395PEP) (0)

There are no reviews for MLL5 Recombinant Protein Antigen (NBP3-17395PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLL5 Recombinant Protein Antigen (NBP3-17395PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLL5 Products

Array NBP3-17395PEP

Research Areas for MLL5 Recombinant Protein Antigen (NBP3-17395PEP)

Find related products by research area.

Blogs on MLL5

There are no specific blogs for MLL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLL5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KMT2E