We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human MLKL GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MLKL Protein [H00197259-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human MLKL GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 371-471 of Human MLKL

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MLKL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.85 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MLKL GST (N-Term) Protein

  • FLJ34389
  • mixed lineage kinase domain-like protein
  • mixed lineage kinase domain-like
  • MLKL

Background

MLKL - mixed lineage kinase domain-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77299
Species: Hu, Mu, Rt
Applications: ELISA, GS, ICC/IF, IHC,  IHC-P, IP, KD, KO, Simple Western, WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
H00010928-M02
Species: Hu, Xp
Applications: ELISA, ICC/IF, IP, WB
NBP1-87826
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-76651
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-16148
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-92257
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-27203
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76749
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00197259-Q01
Species: Hu
Applications: WB, ELISA, Endotoxin, AP

Publications for MLKL Partial Recombinant Protein (H00197259-Q01) (0)

There are no publications for MLKL Partial Recombinant Protein (H00197259-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLKL Partial Recombinant Protein (H00197259-Q01) (0)

There are no reviews for MLKL Partial Recombinant Protein (H00197259-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLKL Partial Recombinant Protein (H00197259-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLKL Products

Research Areas for MLKL Partial Recombinant Protein (H00197259-Q01)

Find related products by research area.

Blogs on MLKL.

Rest in Peace: Is the Receptor Interacting Protein (RIP) Kinase-3 (RIPK3) a Protector or Offender?
By Jamshed Arslan, Pharm. D., PhD. Receptor interacting protein kinases (RIPKs) in necroptosisDeath is perhaps inevitable. Cell death can be programed and immunologically silent (apoptosis), unprogrammed and inflamm...  Read full blog post.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were ...  Read full blog post.

Apoptosis and Necroptosis Part I: Important factors to identify both types of programmed cell death
Different types of cell death have classically been identified by discrete morphological changes. The hallmarks of apoptosis include cell shrinkage, nuclear fragmentation and membrane blebbing whereas necroptosis is characterized by cell swelling ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MLKL GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MLKL