Recombinant Human MLKL Protein

Images

 
SDS-Page: Recombinant Human MLKL Protein [H00197259-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MLKL Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 371 - 471 of Human MLKL partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MLKL
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MLKL Protein

  • FLJ34389
  • mixed lineage kinase domain-like protein
  • mixed lineage kinase domain-like
  • MLKL

Background

MLKL - mixed lineage kinase domain-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-92257
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27203
Species: Hu, Mu, Rt, Po, Ch, ChHa, Eq, Fe, GP, Op, Other, Pm, Rb
Applications: WB, Flow
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
H00197259-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MLKL Partial Recombinant Protein (H00197259-Q01) (0)

There are no publications for MLKL Partial Recombinant Protein (H00197259-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLKL Partial Recombinant Protein (H00197259-Q01) (0)

There are no reviews for MLKL Partial Recombinant Protein (H00197259-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLKL Partial Recombinant Protein (H00197259-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLKL Products

Bioinformatics Tool for MLKL Partial Recombinant Protein (H00197259-Q01)

Discover related pathways, diseases and genes to MLKL Partial Recombinant Protein (H00197259-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLKL Partial Recombinant Protein (H00197259-Q01)

Discover more about diseases related to MLKL Partial Recombinant Protein (H00197259-Q01).
 

Pathways for MLKL Partial Recombinant Protein (H00197259-Q01)

View related products by pathway.

PTMs for MLKL Partial Recombinant Protein (H00197259-Q01)

Learn more about PTMs related to MLKL Partial Recombinant Protein (H00197259-Q01).
 

Research Areas for MLKL Partial Recombinant Protein (H00197259-Q01)

Find related products by research area.

Blogs on MLKL.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were...  Read full blog post.

Apoptosis and Necroptosis Part I: Important factors to identify both types of programmed cell death
Different types of cell death have classically been identified by discrete morphological changes. The hallmarks of apoptosis include cell shrinkage, nuclear fragmentation and membrane blebbing whereas necroptosis is characterized by cell swelling...  Read full blog post.

Customers Who Bought This Also Bought

DRP1 Antibody
NB110-55288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MLKL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MLKL
Entrez