MLH3 Recombinant Protein Antigen

Images

 
There are currently no images for MLH3 Recombinant Protein Antigen (NBP2-55958PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MLH3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLH3.

Source: E. coli

Amino Acid Sequence: TTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLH3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55958.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLH3 Recombinant Protein Antigen

  • DNA mismatch repair protein Mlh3
  • HNPCC7
  • MGC138372
  • mutL (E. coli) homolog 3
  • mutL homolog 3 (E. coli)
  • MutL protein homolog 3

Background

MLH3 is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. The protein encoded by this gene functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-07211
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46459
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NBP3-13739
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94754
Species: Mu, Rt
Applications: ELISA, WB
NBP1-20946
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-16391
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-89929
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP2-95212
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-88052
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-58172
Species: Hu, Mu
Applications: WB

Publications for MLH3 Recombinant Protein Antigen (NBP2-55958PEP) (0)

There are no publications for MLH3 Recombinant Protein Antigen (NBP2-55958PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLH3 Recombinant Protein Antigen (NBP2-55958PEP) (0)

There are no reviews for MLH3 Recombinant Protein Antigen (NBP2-55958PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLH3 Recombinant Protein Antigen (NBP2-55958PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLH3 Products

Research Areas for MLH3 Recombinant Protein Antigen (NBP2-55958PEP)

Find related products by research area.

Blogs on MLH3

There are no specific blogs for MLH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLH3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MLH3