MLC1SA Antibody - BSA Free

Western Blot: MLC1SA Antibody [NBP1-92124] - Analysis in control (vector only transfected HEK293T lysate) and MYL6B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining in human skeletal muscle and duodenum tissues using anti-MYL6B antibody. Corresponding MYL6B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining of human duodenum shows low expression as expected.

Immunohistochemistry-Paraffin: MLC1SA Antibody [NBP1-92124] - Staining of human skeletal muscle shows high expression.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Analysis in human skeletal muscle and liver tissues using NBP1-92124 antibody. Corresponding MYL6B RNA-seq data are presented for the same tissues.

Analysis in human cell line SH-SY5Y.

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human cell line A-431 shows localization to vesicles.

Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MLC1SA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MLC1SA Antibody - BSA Free (NBP1-92124) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MYL6B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MLC1SA Protein (NBP1-92124PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MLC1SA Antibody - BSA Free

• MLC1sa
• MLC1SAmyosin light chain 1, slow-twitch muscle A isoform
• myosin alkali light chain 1 slow a
• myosin light chain 1 slow a
• Myosin light chain 1 slow-twitch muscle A isoform
• myosin light chain 6B
• myosin, light chain 6B, alkali, smooth muscle and non-muscle
• myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle
• smooth muscle and non-muscle myosin alkali light chain 6B
• Smooth muscle and nonmuscle myosin light chain alkali 6B

Background

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYL6B