MKS1 Recombinant Protein Antigen

Images

 
There are currently no images for MKS1 Protein (NBP1-88691PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MKS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKS1.

Source: E. coli

Amino Acid Sequence: TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MKS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88691.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MKS1 Recombinant Protein Antigen

  • BBS13FLJ20345
  • FABB proteome-like protein
  • Meckel syndrome type 1 protein
  • Meckel syndrome, type 1
  • MES
  • MKS
  • POC12 centriolar protein homolog
  • POC12

Background

MKPX, also known as JSP-1 for Jnk Stimulatory Phosphatase-1, belongs to the LMW-DSP subfamily of phosphatases. MKPX has been shown to have the capacity to activate the c-Jun N-terminal kinase (Jnk) signaling pathway. The activation of Jnk has been implicated in a number of important physiological processes, including embryonic morphogenesis, cell survival and apoptosis. At least two mRNA transcripts have been reported. Jnk signaling has been linked to human disease conditions, such as tumor development, cardiac hypertrophy, ischemia/reperfusion injury, diabetes, hyperglycemia-induced apoptosis, and several neurodegenerative disorders.MKPX has been shown to be widely expressed with highest expression in heart, kidney, liver, lung, pancreas and placenta. ESTs have been isolated from a diverse set of human tissues libraries, especially blood and breast.Caution: The acronym MKPX also has been used to describe Dual Specificity Protein Phosphatase 7.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84954
Species: Hu
Applications: IHC,  IHC-P
NBP1-06590
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81427
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-83299
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NB100-86991
Species: Hu, Mu
Applications: ICC/IF, IP, WB
AF5866
Species: Hu
Applications: IHC, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC
423-F8
Species: Hu, Mu
Applications: BA
NBP1-84403
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-92821
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB

Publications for MKS1 Protein (NBP1-88691PEP) (0)

There are no publications for MKS1 Protein (NBP1-88691PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKS1 Protein (NBP1-88691PEP) (0)

There are no reviews for MKS1 Protein (NBP1-88691PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MKS1 Protein (NBP1-88691PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MKS1 Products

Research Areas for MKS1 Protein (NBP1-88691PEP)

Find related products by research area.

Blogs on MKS1

There are no specific blogs for MKS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MKS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MKS1