We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MKRN3 Recombinant Protein Antigen

Images

 
There are currently no images for MKRN3 Protein (NBP1-84320PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MKRN3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKRN3.

Source: E. coli

Amino Acid Sequence: SGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFFEAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MKRN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84320.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MKRN3 Recombinant Protein Antigen

  • EC 6.3.2.-
  • makorin ring finger protein 3
  • MGC88288
  • RNF63D15S9
  • ZFP127RING finger protein 63
  • Zinc finger protein 127
  • ZNF127probable E3 ubiquitin-protein ligase makorin-3

Background

MKRN3, also known as Probable E3 ubiquitin-protein ligase makorin-3, is a 507 amino acid protein that is 56 kDa, contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs, and acts as a catalyzer of the covalent attachment of ubiquitin moieties onto substrate proteins. Current research is being performed on this protein involvement in Prader-Willi syndrome, Angelman syndrome, Canavan disease, and intellectual disability. This protein is necessary for protein ubiquitination forming interaction with TSG101, UBE2D2, UBE2D3, UBE2I, UBE2N, UBE2V1, UBE2W, UBE2U, UBE2D1, UBE2D4, UBE2E1, UBE2E2, UBE2H, UBE2K, UBE2L3, UBE2V2, UBE2E3, C11orf57, ENKD1, LRSAM1, MDM2, and over 20 other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
H00004692-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-93603
Species: Hu, Mu
Applications: WB
NBP3-09393
Species: Hu
Applications: WB
NBP1-89917
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89092
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-199
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87299
Species: Hu
Applications: ICC/IF, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-85946
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-46379
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-514
Species: Bv, Hu, Mu, Pm, Rt
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00006047-A01
Species: Hu
Applications: ELISA, IP, WB
NBP2-82939
Species: Hu
Applications: WB
H00008926-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-78028
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-46466
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB

Publications for MKRN3 Protein (NBP1-84320PEP) (0)

There are no publications for MKRN3 Protein (NBP1-84320PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN3 Protein (NBP1-84320PEP) (0)

There are no reviews for MKRN3 Protein (NBP1-84320PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MKRN3 Protein (NBP1-84320PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MKRN3 Products

Research Areas for MKRN3 Protein (NBP1-84320PEP)

Find related products by research area.

Blogs on MKRN3

There are no specific blogs for MKRN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MKRN3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MKRN3