MiRP3 Recombinant Protein Antigen

Images

 
There are currently no images for MiRP3 Protein (NBP1-81049PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MiRP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNE4.

Source: E.coli

Amino Acid Sequence: EKKSSLLLLYKDEERLWGEAMKPLPVVSGLRSVQVPLMLNMLQESVAPALSCTLCSMEGDSVSSESSSPDVHLTIQEEGADDELEETSETPLNESSEGSSEN

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNE4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-81049.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MiRP3 Recombinant Protein Antigen

  • cardiac voltage-gated potassium channel accessory subunit 4
  • MGC20353
  • Minimum potassium ion channel-related peptide 3
  • MinK-related peptide 3
  • MiRP3
  • Potassium channel subunit beta MiRP3
  • potassium voltage-gated channel subfamily E member 4
  • potassium voltage-gated channel, Isk-related family, member 4

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from bothfunctional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heartrate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cellvolume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is atype I membrane protein, and a beta subunit that assembles with a potassium channel alpha-subunit to modulate thegating kinetics and enhance stability of the multimeric complex. This gene is prominently expressed in the embryo andin adult uterus. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-49885
Species: Bv, Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-85835
Species: Hu
Applications: IHC, IHC-P
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP1-84732
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DNST0
Species: Hu
Applications: ELISA
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-03750
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00003738-M01
Species: Hu
Applications: ELISA, WB
NBP2-84125
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-60655
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB8400
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP3-03748
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
NBP3-03729
Species: Mu, Rt
Applications: ICC/IF, IHC
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-81049PEP
Species: Hu
Applications: AC

Publications for MiRP3 Protein (NBP1-81049PEP) (0)

There are no publications for MiRP3 Protein (NBP1-81049PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP3 Protein (NBP1-81049PEP) (0)

There are no reviews for MiRP3 Protein (NBP1-81049PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MiRP3 Protein (NBP1-81049PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MiRP3 Products

Bioinformatics Tool for MiRP3 Protein (NBP1-81049PEP)

Discover related pathways, diseases and genes to MiRP3 Protein (NBP1-81049PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP3 Protein (NBP1-81049PEP)

Discover more about diseases related to MiRP3 Protein (NBP1-81049PEP).
 

Pathways for MiRP3 Protein (NBP1-81049PEP)

View related products by pathway.

PTMs for MiRP3 Protein (NBP1-81049PEP)

Learn more about PTMs related to MiRP3 Protein (NBP1-81049PEP).

Blogs on MiRP3

There are no specific blogs for MiRP3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MiRP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE4