Recombinant Human MiRP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MiRP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 73-123 of Human KCNE2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Protein/Peptide Type
Partial Recombinant Protein
Gene
KCNE2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MiRP1 Protein

  • ATFB4
  • cardiac voltage-gated potassium channel accessory subunit 2
  • human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1
  • LQT5
  • LQT6
  • MGC138292
  • MinK-related peptide 1
  • minK-related peptide-1
  • MIRP1
  • Potassium channel subunit beta MiRP1
  • potassium channel subunit, MiRP1
  • potassium voltage-gated channel subfamily E member 2
  • potassium voltage-gated channel, Isk-related family, member 2
  • voltage-gated K+ channel subunit MIRP1

Background

KCNE2 - potassium voltage-gated channel, Isk-related family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBL1-12154
Species: Hu
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
NBL1-12155
Species: Hu
NBP1-83238
Species: Hu
Applications: IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85835
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33863
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19315
Species: Hu
Applications: WB
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-12895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-81049
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MiRP1 Partial Recombinant Protein (H00009992-Q01) (0)

There are no publications for MiRP1 Partial Recombinant Protein (H00009992-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP1 Partial Recombinant Protein (H00009992-Q01) (0)

There are no reviews for MiRP1 Partial Recombinant Protein (H00009992-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MiRP1 Partial Recombinant Protein (H00009992-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MiRP1 Products

Bioinformatics Tool for MiRP1 Partial Recombinant Protein (H00009992-Q01)

Discover related pathways, diseases and genes to MiRP1 Partial Recombinant Protein (H00009992-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP1 Partial Recombinant Protein (H00009992-Q01)

Discover more about diseases related to MiRP1 Partial Recombinant Protein (H00009992-Q01).
 

Pathways for MiRP1 Partial Recombinant Protein (H00009992-Q01)

View related products by pathway.

PTMs for MiRP1 Partial Recombinant Protein (H00009992-Q01)

Learn more about PTMs related to MiRP1 Partial Recombinant Protein (H00009992-Q01).

Blogs on MiRP1

There are no specific blogs for MiRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MiRP1 Antibody
NBP2-38146

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MiRP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE2