MICB Recombinant Protein Antigen

Images

 
There are currently no images for MICB Recombinant Protein Antigen (NBP2-56506PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MICB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MICB.

Source: E. coli

Amino Acid Sequence: CKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MICB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56506.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MICB Recombinant Protein Antigen

  • MHC class I chain-related protein B
  • MHC class I mic-B antigen
  • MHC class I polypeptide-related sequence B
  • MICB
  • MIC-B
  • PERB11.2MHC class I-like molecule PERB11.2-IMX
  • stress inducible class I homolog

Background

MICB encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
DY1298
Species: Hu
Applications: ELISA
MAB1380
Species: Hu
Applications: Block, CyTOF-ready, Flow
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NB100-64775
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, Func, IHC, IHC-Fr, IHC-P (-), IP
NBP2-45316
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
MAB1517
Species: Hu
Applications: Block, CyTOF-ready, Flow
247-ILB
Species: Hu
Applications: BA
NBP3-46107
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-07168
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
MAB97861
Species: Hu
Applications: Flow, IHC,  IHC-P
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB

Publications for MICB Recombinant Protein Antigen (NBP2-56506PEP) (0)

There are no publications for MICB Recombinant Protein Antigen (NBP2-56506PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICB Recombinant Protein Antigen (NBP2-56506PEP) (0)

There are no reviews for MICB Recombinant Protein Antigen (NBP2-56506PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MICB Recombinant Protein Antigen (NBP2-56506PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MICB Products

Research Areas for MICB Recombinant Protein Antigen (NBP2-56506PEP)

Find related products by research area.

Blogs on MICB.

Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MICB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MICB