Home » MGC20410 » MGC20410 Antibodies » MGC20410 Antibody

MGC20410 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MGC20410 Antibody [H00116071-B02P] - Analysis of BATF2 expression in transfected 293T cell line by BATF2 polyclonal antibody. Lane 1: MGC20410 transfected lysate(20.9 KDa). Lane 2: Non-transfected lysate.
Western Blot: MGC20410 Antibody [H00116071-B02P] - Analysis of BATF2 expression in transfected 293T cell line by BATF2 polyclonal antibody. Lane 1: MGC20410 transfected lysate(20.9 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MGC20410 Antibody Summary

Immunogen
BATF2 (AAH12330, 1 a.a. - 189 a.a.) full-length human protein. MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Specificity
BATF2 - basic leucine zipper transcription factor, ATF-like 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BATF2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MGC20410 Antibody

  • basic leucine zipper transcription factor, ATF-like 2
  • basic leucine zipper transcriptional factor ATF-like 2
  • B-ATF-2
  • MGC20410
  • SARI
  • suppressor of AP-1 regulated by IFN

Background

BATF2 (Basic leucine zipper transcriptional factor ATF-like 2) is a 274 amino acid member of the AP-1 transcription factor family. It controls the differentiation of lineage-specific cells in the immune system. It participates in differentiating CD8+ thymic conventional dendritic cells and acts by forming a heterodimer with JUN family proteins. They then recognize and bind the DNA sequence 5'-TGA(CG)TCA-3'. It acts as a tumor suppressor by interfering with AP-1 regulated activation of CYR61/CCN1 transcription and its downstream signaling. CYR61/CCN1 signaling induces anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western blot shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery. PVDF membrane was probed with 0.5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-c‑Jun (S63) at approximately 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
c‑Junphosphorylated at S63 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line treated with Anisomycin using Rabbit Anti-HumanPhospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) at 1 μg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HEK293T human embryonic kidney cell line untreated (-) or treated (+) with 20 mJ/cm2 ultraviolet light (UV) with a 30 minute recovery, loaded at 0.2 mg/mL. A specific band was detected for Phospho-c‑Jun (S63) at approximately 49 kDa (as indicated) using 5 μg/mL of Rabbit Anti-Human Phospho-c‑Jun (S63) Monoclonal Antibody (Catalog # MAB8930) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
NHE6/SLC9A6
Antibody
NBP2-38877
Immunocytochemistry/Immunofluorescence: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: NHE6/SLC9A6 Antibody [NBP2-38877] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(13 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
FosB/G0S3 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Goat Anti-Human FosB/G0S3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2214) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
FosB/G0S3 was detected in immersion fixed paraffin-embedded sections of human pancreas array using Goat Anti-Human FosB/G0S3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2214) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: ICC, IHC, WB
JunD Antibody
(512709)
MAB5526
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, 293T human embryonic kidney cell line, Jurkat human acute T cell leukemia cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse JunD Monoclonal Antibody (Catalog # MAB5526) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for JunD at approximately 40 kDa and 45 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Publications)
Species: Hu, Mu
Applications: WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/Immunofluorescence: JunB/AP-1 Antibody [NBP1-89544] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: JunB/AP-1 Antibody [NBP1-89544] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cytokeratin 5
Antibody (EP1601Y)
NB110-56916
Western Blot: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Expression of cytokeratins (CK) and GAPDH in HMGEC. Representative western blots show specific bands for GAPDH, CK1, Cytokeratin 5, CK6 and CK14. Image collected and cropped by CiteAb from the following publication (https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0128096) licensed under a CC-BY licence.
Simple Western: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - Simple Western lane view shows a specific band for Cytokeratin 5 in 0.5 mg/ml of A431 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (EP1601Y) [NB110-56916] - A431 cells.
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ARIH1 Antibody
NB100-1162
Western Blot: ARIH1 Antibody [NB100-1162] - (0.5ug/ml) of U937 lysate (RIPA buffer, 30ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.
Immunohistochemistry-Paraffin: ARIH1 Antibody [NB100-1162] - staining of paraffin embedded Human Adrenal Gland. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
ITK Antibody (5G6)
NBP2-37578
ELISA: ITK Antibody (5G6) [NBP2-37578] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: ITK Antibody (5G6) [NBP2-37578] - Analysis using ITK mAb against human ITK (AA: 2-120) recombinant protein. (Expected MW is 39.7 kDa)
Western Blot: ITK Antibody (5G6) [NBP2-37578] - Analysis using ITK mouse mAb against Jurkat cell lysate.
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
DYX1C1 Antibody
NBP1-68766
Immunohistochemistry-Paraffin: DYX1C1 Antibody [NBP1-68766] - Staining of paraffin embedded Human Cerebral Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: DYX1C1 Antibody [NBP1-68766] - Staining (0.1ug/ml) of COS1 cell lysates: untransfected (left lane) and transfected with full length recombinant Human DYX1C1 (right lane).
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
SLC22A3 Antibody
NBP1-83976
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human prostate shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: SLC22A3 Antibody [NBP1-83976] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PEX7 Antibody
NBP1-57578
Western Blot: PEX7 Antibody [NBP1-57578] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin: Sialin/SLC17A5 Antibody [NBP2-20383] - Mouse lung diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: SLC17A5 Antibody [NBP2-20383] - Sample (30 ug of whole cell lysate) A: Jurkat 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SLC17A5 Antibody [NBP2-20383] - Sample: HepG2 cells were fixed in -20C 100% MeOH for 5 min. Green: SLC17A5 protein stained by SLC17A5 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
Cyclin A2 Antibody
NBP1-31330
Western Blot: Cyclin A2 Antibody [NBP1-31330] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Cyclin A2 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: Cyclin A2 Antibody [NBP1-31330] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Cyclin A2 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cyclin A2 Antibody [NBP1-31330] - Detects Cyclin A2 protein at nucleus by immunofluorescent analysis.Sample: HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min.Green: Cyclin A2 stained by Cyclin A2 antibody diluted at 1:500.Red: phalloidin, a cytoskeleton marker, diluted at 1:100.Scale bar= 10 um.
(3 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(46 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NELF-E Antibody
NBP1-88036
Immunohistochemistry-Paraffin: NELF-E Antibody [NBP1-88036] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: NELF-E Antibody [NBP1-88036] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: NELF-E Antibody [NBP1-88036] - Staining of human small intestine shows weak to moderate nuclear positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for MGC20410 Antibody (H00116071-B02P) (0)

There are no publications for MGC20410 Antibody (H00116071-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGC20410 Antibody (H00116071-B02P) (0)

There are no reviews for MGC20410 Antibody (H00116071-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGC20410 Antibody (H00116071-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MGC20410 Products

Bioinformatics Tool for MGC20410 Antibody (H00116071-B02P)

Discover related pathways, diseases and genes to MGC20410 Antibody (H00116071-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGC20410 Antibody (H00116071-B02P)

Discover more about diseases related to MGC20410 Antibody (H00116071-B02P).
 

Pathways for MGC20410 Antibody (H00116071-B02P)

View related products by pathway.

Blogs on MGC20410

There are no specific blogs for MGC20410, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGC20410 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol BATF2
Entrez
Uniprot