MGC20410 Antibody Summary
Immunogen |
BATF2 (AAH12330, 1 a.a. - 189 a.a.) full-length human protein. MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF |
Specificity |
BATF2 - basic leucine zipper transcription factor, ATF-like 2, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
BATF2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MGC20410 Antibody
Background
BATF2 (Basic leucine zipper transcriptional factor ATF-like 2) is a 274 amino acid member of the AP-1 transcription factor family. It controls the differentiation of lineage-specific cells in the immune system. It participates in differentiating CD8+ thymic conventional dendritic cells and acts by forming a heterodimer with JUN family proteins. They then recognize and bind the DNA sequence 5'-TGA(CG)TCA-3'. It acts as a tumor suppressor by interfering with AP-1 regulated activation of CYR61/CCN1 transcription and its downstream signaling. CYR61/CCN1 signaling induces anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Publications for MGC20410 Antibody (H00116071-B02P) (0)
There are no publications for MGC20410 Antibody (H00116071-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MGC20410 Antibody (H00116071-B02P) (0)
There are no reviews for MGC20410 Antibody (H00116071-B02P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MGC20410 Antibody (H00116071-B02P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MGC20410 Products
Bioinformatics Tool for MGC20410 Antibody (H00116071-B02P)
Discover related pathways, diseases and genes to MGC20410 Antibody (H00116071-B02P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MGC20410 Antibody (H00116071-B02P)
Discover more about diseases related to MGC20410 Antibody (H00116071-B02P).
| | Pathways for MGC20410 Antibody (H00116071-B02P)
View related products by pathway.
|
Blogs on MGC20410