MGC20410 Antibody

Images

 
Western Blot: MGC20410 Antibody [H00116071-B02P] - Analysis of BATF2 expression in transfected 293T cell line by BATF2 polyclonal antibody. Lane 1: MGC20410 transfected lysate(20.9 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MGC20410 Antibody Summary

Immunogen
BATF2 (AAH12330, 1 a.a. - 189 a.a.) full-length human protein. MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Specificity
BATF2 - basic leucine zipper transcription factor, ATF-like 2,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BATF2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MGC20410 Antibody

  • basic leucine zipper transcription factor, ATF-like 2
  • basic leucine zipper transcriptional factor ATF-like 2
  • B-ATF-2
  • MGC20410
  • SARI
  • suppressor of AP-1 regulated by IFN

Background

BATF2 (Basic leucine zipper transcriptional factor ATF-like 2) is a 274 amino acid member of the AP-1 transcription factor family. It controls the differentiation of lineage-specific cells in the immune system. It participates in differentiating CD8+ thymic conventional dendritic cells and acts by forming a heterodimer with JUN family proteins. They then recognize and bind the DNA sequence 5'-TGA(CG)TCA-3'. It acts as a tumor suppressor by interfering with AP-1 regulated activation of CYR61/CCN1 transcription and its downstream signaling. CYR61/CCN1 signaling induces anchorage-independent growth and invasion in several cancer types, such as breast cancer, malignant glioma and metastatic melanoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
AF2214
Species: Hu
Applications: ICC, IHC, WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-56916
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-1162
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-37578
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP1-31330
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-88036
Species: Hu
Applications: IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for MGC20410 Antibody (H00116071-B02P) (0)

There are no publications for MGC20410 Antibody (H00116071-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGC20410 Antibody (H00116071-B02P) (0)

There are no reviews for MGC20410 Antibody (H00116071-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGC20410 Antibody (H00116071-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MGC20410 Products

Bioinformatics Tool for MGC20410 Antibody (H00116071-B02P)

Discover related pathways, diseases and genes to MGC20410 Antibody (H00116071-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGC20410 Antibody (H00116071-B02P)

Discover more about diseases related to MGC20410 Antibody (H00116071-B02P).
 

Pathways for MGC20410 Antibody (H00116071-B02P)

View related products by pathway.

Blogs on MGC20410

There are no specific blogs for MGC20410, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MGC20410 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BATF2
Entrez
Uniprot