Recombinant Human MGAT5B GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MGAT5B GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 394 of Human MGAT5B full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQRQRRLRSSQEQARCGVMGACEKMLLEGDVASNTLLIEKPSKKETEKCPKNLVT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MGAT5B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
70.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MGAT5B GST (N-Term) Protein

  • alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
  • Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
  • beta(1,6)-N-acetylglucosaminyltransferase V
  • EC 2.4.1.-
  • EC 2.4.1.155
  • FLJ25132
  • GlcNAc-T Vb
  • GnT-IX
  • GnT-VB
  • hGnTVb
  • isoenzyme B
  • isozyme B
  • KIAA2008
  • Mannoside acetylglucosaminyltransferase 5B
  • mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase
  • N-acetylglucosaminyltransferase IX
  • N-acetylglucosaminyl-transferase Vb

Background

The MGAT5B gene encodes a beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.155) that functions in the synthesis of complex cell surface N-glycans (Kaneko et al., 2003 [PubMed 14623122]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5469
Species: Hu
Applications: ICC, WB
7414-GT
Species: Hu
Applications: EnzAct
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF2746
Species: Hu, Mu
Applications: ICC, WB
2496-ZN
Species: Hu
Applications: EnzAct
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP1-82279
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52911
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF1056
Species: Rt
Applications: IHC, WB
NBP2-01763
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB

Publications for MGAT5B Recombinant Protein (H00146664-P01) (0)

There are no publications for MGAT5B Recombinant Protein (H00146664-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGAT5B Recombinant Protein (H00146664-P01) (0)

There are no reviews for MGAT5B Recombinant Protein (H00146664-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MGAT5B Recombinant Protein (H00146664-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MGAT5B Products

Array H00146664-P01

Bioinformatics Tool for MGAT5B Recombinant Protein (H00146664-P01)

Discover related pathways, diseases and genes to MGAT5B Recombinant Protein (H00146664-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MGAT5B Recombinant Protein (H00146664-P01)

Discover more about diseases related to MGAT5B Recombinant Protein (H00146664-P01).
 

Pathways for MGAT5B Recombinant Protein (H00146664-P01)

View related products by pathway.

PTMs for MGAT5B Recombinant Protein (H00146664-P01)

Learn more about PTMs related to MGAT5B Recombinant Protein (H00146664-P01).
 

Research Areas for MGAT5B Recombinant Protein (H00146664-P01)

Find related products by research area.

Blogs on MGAT5B

There are no specific blogs for MGAT5B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MGAT5B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MGAT5B