MGAT4B Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGAT4B Source: E. coli
Amino Acid Sequence: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLLAKESSLQPAVRVGQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
MGAT4B |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17394. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MGAT4B Recombinant Protein Antigen
Background
MGAT4B, also known as Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, has 3 isoforms, a 548 amino acid isoform that is 63 kDa, a 547 amino acid isoform that is 63 kDa, and a 563 amino acid isoform that is 65 kDa; participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans; acts as a catalyzer in the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans; necessary for the production of tri- and tetra-antennary N-linked sugar chains, and it is not the main contributor in N-glycan biosynthesis. Disease research is currently being performed with relation to MGAT4B and immunodeficiency, pancreatic cancer, hepatocellular carcinoma, pancreatitis, interferon, carcinoma, and extrahepatic bile duct carcinoma. Interactions with this protein have been shown to involve LRSAM1, MGAT2, MGAT3, MGAT5, FUT8, and MGAT5B in N-glycan antennae elongation in the medial/trans-Golgi, transport to the Golgi and subsequent modification, asparagine N-linked glycosylation, N-Glycan antennae elongation, methabolism of proteins, N-Glycan biosynthesis, and metabolic pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for MGAT4B Recombinant Protein Antigen (NBP3-17394PEP) (0)
There are no publications for MGAT4B Recombinant Protein Antigen (NBP3-17394PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MGAT4B Recombinant Protein Antigen (NBP3-17394PEP) (0)
There are no reviews for MGAT4B Recombinant Protein Antigen (NBP3-17394PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MGAT4B Recombinant Protein Antigen (NBP3-17394PEP) (0)
Additional MGAT4B Products
Research Areas for MGAT4B Recombinant Protein Antigen (NBP3-17394PEP)
Find related products by research area.
|
Blogs on MGAT4B