MFSD9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MFSD9 Antibody [NBP2-57652] - Staining of human cell line Hep G2 shows localization to nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFSD9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGSTEKGLPLRKTHVLLGRSHDTVQEAATSRRARASKKTAQPWVEVVLALRNMKNLLF
Specificity
Specificity of human MFSD9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFSD9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MFSD9 Antibody

  • major facilitator superfamily domain containing 9
  • major facilitator superfamily domain-containing protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-88153
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-47607
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-80734
Species: Hu
Applications: IHC, IHC-P
NBP2-01826
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
NBP1-79801
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59624
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP1-81224
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59892
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-82203
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57998
Species: Hu
Applications: ICC/IF
NBP1-59440
Species: Hu, Rt
Applications: WB
NBP2-68817
Species: Hu
Applications: IHC, IHC-P
NBP2-14511
Species: Hu
Applications: IHC, IHC-P
NBP1-89061
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MFSD9 Antibody (NBP2-57652) (0)

There are no publications for MFSD9 Antibody (NBP2-57652).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFSD9 Antibody (NBP2-57652) (0)

There are no reviews for MFSD9 Antibody (NBP2-57652). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MFSD9 Antibody (NBP2-57652) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MFSD9 Products

Bioinformatics Tool for MFSD9 Antibody (NBP2-57652)

Discover related pathways, diseases and genes to MFSD9 Antibody (NBP2-57652). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFSD9 Antibody (NBP2-57652)

Discover more about diseases related to MFSD9 Antibody (NBP2-57652).

Blogs on MFSD9

There are no specific blogs for MFSD9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFSD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFSD9