Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE |
Specificity | Specificity of human, mouse METTL14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
Isotype | IgG2a |
Clonality | Monoclonal |
Host | Mouse |
Gene | METTL14 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for METTL14 Antibody (NBP2-59043)Discover more about diseases related to METTL14 Antibody (NBP2-59043).
| Pathways for METTL14 Antibody (NBP2-59043)View related products by pathway.
|
Research Areas for METTL14 Antibody (NBP2-59043)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | METTL14 |