METTL14 Antibody (CL4252)

Images

 
Western Blot: METTL14 Antibody (CL4252) [NBP2-59043] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: METTL14 Antibody (CL4252) [NBP2-59043] - Staining of RH-30 cells using the Anti-METTL14 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: METTL14 Antibody (CL4252) [NBP2-59043] - Staining in human testis and skeletal muscle tissues. Corresponding METTL14 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: METTL14 Antibody (CL4252) [NBP2-59043] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: METTL14 Antibody (CL4252) [NBP2-59043] - Staining of human endometrium shows strong nuclear positivity in glandular and stromal cells.
Immunohistochemistry-Paraffin: METTL14 Antibody (CL4252) [NBP2-59043] - Staining of human duodenum shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: METTL14 Antibody (CL4252) [NBP2-59043] - Staining of human skeletal muscle shows only weak nuclear positivity in striated muscle fibers.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clone
CL4252
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

METTL14 Antibody (CL4252) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Specificity
Specificity of human, mouse METTL14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
METTL14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 2-10 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.
Control Peptide
METTL14 Recombinant Protein Antigen (NBP2-59043PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for METTL14 Antibody (CL4252)

  • EC 2.1.1
  • EC 2.1.1.-
  • KIAA1627
  • KIAA1627methyltransferase-like protein 14
  • methyltransferase like 14
  • METTL14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47318
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt, Ba, Pp, I, Pm
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-93547
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB7325
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03819
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC, KO
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56363
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59043
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for METTL14 Antibody (NBP2-59043) (0)

There are no publications for METTL14 Antibody (NBP2-59043).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL14 Antibody (NBP2-59043) (0)

There are no reviews for METTL14 Antibody (NBP2-59043). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for METTL14 Antibody (NBP2-59043) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional METTL14 Products

Bioinformatics Tool for METTL14 Antibody (NBP2-59043)

Discover related pathways, diseases and genes to METTL14 Antibody (NBP2-59043). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for METTL14 Antibody (NBP2-59043)

Discover more about diseases related to METTL14 Antibody (NBP2-59043).
 

Pathways for METTL14 Antibody (NBP2-59043)

View related products by pathway.

Research Areas for METTL14 Antibody (NBP2-59043)

Find related products by research area.

Blogs on METTL14

There are no specific blogs for METTL14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL14 Antibody (CL4252) and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL14