METT10D Antibody

Images

 
Western Blot: METT10D Antibody [NBP1-79255] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

METT10D Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human METT10D. Peptide sequence: LNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against METT10D and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for METT10D Antibody

  • EC 2.1.1.-
  • methyltransferase 10 domain containing
  • Methyltransferase 10 domain-containing protein
  • methyltransferase like 16
  • METT10D
  • MGC3329
  • putative methyltransferase METT10D

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31010
Species: Hu
Applications: WB, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
AF6379
Species: Hu
Applications: WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14362
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
AF5810
Species: Hu, Mu
Applications: WB, IHC
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-46191
Species: Hu, Mu
Applications: WB, IP
NBP2-30525
Species: Hu
Applications: IHC, IHC-P
NBP2-75670
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for METT10D Antibody (NBP1-79255) (0)

There are no publications for METT10D Antibody (NBP1-79255).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METT10D Antibody (NBP1-79255) (0)

There are no reviews for METT10D Antibody (NBP1-79255). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for METT10D Antibody (NBP1-79255) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for METT10D Antibody (NBP1-79255)

Discover related pathways, diseases and genes to METT10D Antibody (NBP1-79255). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METT10D

There are no specific blogs for METT10D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METT10D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL16
Uniprot