Methyltransferase like 3 Antibody

Images

 
Western Blot: Methyltransferase like 3 Antibody [NBP2-82284] - WB Suggested Anti-METTL3 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: Human Thymus
Immunohistochemistry: Methyltransferase like 3 Antibody [NBP2-82284] - Human Intestine
Western Blot: Methyltransferase like 3 Antibody [NBP2-82284] - Host: Rabbit. Target: METTL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): Human Liver Tumor (T-LI). Antibody concentration: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Methyltransferase like 3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human Methyltransferase like 3. Peptide sequence: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
METTL3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for Methyltransferase like 3 Antibody

  • adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase
  • EC 2.1.1.62
  • IME4
  • M6A
  • methyltransferase like 3
  • Methyltransferase-like protein 3
  • MGC4336
  • mRNA m(6)A methyltransferase
  • MTA70
  • MT-A70
  • N6-adenosine-methyltransferase 70 kDa subunit
  • Spo8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81271
Species: Hu
Applications: Flow, IHC, IHC-P
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-85000
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-35224
Species: Hu
Applications: Func, PAGE
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-93574
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52406
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
256-GF/CF
Species: Hu
Applications: BA
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-72047
Species: Hu, Mu, Po, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-98496
Species: Hu
Applications: WB
NBP2-59379
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-92609
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for Methyltransferase like 3 Antibody (NBP2-82284) (0)

There are no publications for Methyltransferase like 3 Antibody (NBP2-82284).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methyltransferase like 3 Antibody (NBP2-82284) (0)

There are no reviews for Methyltransferase like 3 Antibody (NBP2-82284). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methyltransferase like 3 Antibody (NBP2-82284) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Methyltransferase like 3 Products

Bioinformatics Tool for Methyltransferase like 3 Antibody (NBP2-82284)

Discover related pathways, diseases and genes to Methyltransferase like 3 Antibody (NBP2-82284). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methyltransferase like 3 Antibody (NBP2-82284)

Discover more about diseases related to Methyltransferase like 3 Antibody (NBP2-82284).
 

Pathways for Methyltransferase like 3 Antibody (NBP2-82284)

View related products by pathway.

PTMs for Methyltransferase like 3 Antibody (NBP2-82284)

Learn more about PTMs related to Methyltransferase like 3 Antibody (NBP2-82284).

Blogs on Methyltransferase like 3

There are no specific blogs for Methyltransferase like 3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methyltransferase like 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL3