Methyltransferase like 3 Antibody - BSA Free

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284] - WB Suggested Anti-METTL3 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:312500. Positive Control: Human Thymus

Immunohistochemistry: Methyltransferase like 3 Antibody [NBP2-82284] - Human Intestine

Western Blot: Methyltransferase like 3 Antibody [NBP2-82284] - Host: Rabbit. Target: METTL3. Positive control (+): HepG2 Cell Lysate (HG). Negative control (-): Human Liver Tumor (T-LI). Antibody concentration: 1ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Methyltransferase like 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Methyltransferase like 3 Antibody - BSA Free (NBP2-82284) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Methyltransferase like 3. Peptide sequence: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: METTL3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Methyltransferase like 3 Antibody - BSA Free

• adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase
• EC 2.1.1.62
• IME4
• M6A
• methyltransferase like 3
• Methyltransferase-like protein 3
• MGC4336
• mRNA m(6)A methyltransferase
• MTA70
• MT-A70
• N6-adenosine-methyltransferase 70 kDa subunit
• Spo8

Background

Methyltransferase like 3 encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: METTL3