MERIT40/HSPC142 Recombinant Protein Antigen

Images

 
There are currently no images for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MERIT40/HSPC142 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MERIT40/HSPC142.

Source: E. coli

Amino Acid Sequence: EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BABAM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58126.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MERIT40/HSPC142 Recombinant Protein Antigen

  • BABAM1
  • BRISC and BRCA1 A complex member 1
  • C10orf62
  • C19orf62
  • chromosome 19 open reading frame 62
  • FLJ20571
  • HSPC142
  • mediator of Rap80 interactions and targeting 40 kDa
  • Mediator of RAP80 interactions and targeting subunit of 40 kDa
  • MERIT40
  • MERIT40BRCA1-A complex subunit MERIT40
  • NBA1
  • NBA1BRISC and BRCA1 A complex member
  • new component of the BRCA1 A complex
  • New component of the BRCA1-A complex
  • new component of the BRCAA1 A complex

Background

HSPC142 is a component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76831
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NBP1-87156
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32304
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, KO, WB
NBP2-56444
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-319
Species: Hu
Applications: IP, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PLA, Simple Western, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24694
Species: Ca, Eq, Hu, Mu, Pm, Rt
Applications: WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
MAB2476
Species: Hu
Applications: IHC, WB
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC,  IHC-P, WB
AF7217
Species: Hu, Mu
Applications: ICC, WB
NB100-395
Species: Hu, Mu
Applications: ICC/IF, IP, WB

Publications for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP) (0)

There are no publications for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP) (0)

There are no reviews for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MERIT40/HSPC142 Products

Research Areas for MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP)

Find related products by research area.

Blogs on MERIT40/HSPC142

There are no specific blogs for MERIT40/HSPC142, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MERIT40/HSPC142 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BABAM1