MEKK2 Antibody

Product Discontinued

MEKK2 Antibody Summary

• Immunogen: Synthetic peptides corresponding to MAP3K2(mitogen-activated protein kinase kinase kinase 2) The peptide sequence was selected from the N terminal of MAP3K2. Peptide sequence AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE.
• Predicted Species: Rat (93%), Porcine (100%), Guinea Pig (92%), Bovine (100%), Rabbit (93%), Zebrafish (100%), Canine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP3K2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against MAP3K2 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MEKK2 Antibody

• EC 2.7.11.25
• MAP/ERK kinase kinase 2
• MAP3K2
• MAPK/ERK kinase kinase 2
• MAPKKK2
• MEK kinase 2
• MEKK 2
• MEKK2
• MEKK2B
• mitogen-activated protein kinase kinase kinase 2

Background

MAP3K2 is a component of a protein kinase signal transduction cascade. It regulates the JNK and ERK5 pathways by phosphorylating and activating MAP2K5 and MAP2K7. It also plays a role in caveolae kiss-and-run dynamics.The protein encoded by this gene is a member of serine/threonine protein kinase family. This kinase preferentially activates other kinases involved in the MAP kinase signaling pathway. This kinase has been shown to directly phosphorylate and activate Ikappa B kinases, and thus plays a role in NF-kappa B signaling pathway. This kinase has also been found to bind and activate protein kinase C-related kinase 2, which suggests its involvement in a regulated signaling process. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-18 AF111105.1 37-54 19-79 AI760702.1 474-534 80-371 AF111105.1 116-407 372-2650 AB208963.1 313-2591 2651-3557 AK075004.1 2050-2956 3558-3571 BQ423724.1 71-84 3572-3577 W07290.1 11-16 3578-4302 AK074577.1 1-725 4303-4421 BM470563.1 21-139 4422-4424 AK074577.1 845-847 4425-4941 BM470563.1 142-658

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAP3K2
• Uniprot:
  • Q9Y2U5()