Meis homeobox 3 Antibody (4E12) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Meis homeobox 3 Antibody (4E12) - Azide and BSA Free (H00056917-M07) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
MEIS3 (NP_001009813.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIA |
| Specificity |
Reacts with Meis homeobox 3. |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MEIS3 |
| Purity |
Protein A purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is reactive against recombinant protein in western blot and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Meis homeobox 3 Antibody (4E12) - Azide and BSA Free
Background
MEIS3, also known as Homeobox protein Meis3, has 3 isoforms, a 375 amino acid isoform that is 41 kDa, a 421 amino acid isoform that is 46 kDa, and a 358 amino acid isoform that is 39 kDa, and is nucleus located. Little is currently known about its function. Studies are performed on the relationship of this protein to neuronitis. MEIS3 protein involvement has been observed with relation to HOXA13 in the regulation of transcription, DNA-dependent, negative regulation of apoptotic process, and positive regulation of protein kinase B signaling cascade pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: WB, ELISA
Publications for Meis homeobox 3 Antibody (H00056917-M07) (0)
There are no publications for Meis homeobox 3 Antibody (H00056917-M07).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Meis homeobox 3 Antibody (H00056917-M07) (0)
There are no reviews for Meis homeobox 3 Antibody (H00056917-M07).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Meis homeobox 3 Antibody (H00056917-M07) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Meis homeobox 3 Products
Research Areas for Meis homeobox 3 Antibody (H00056917-M07)
Find related products by research area.
|
Blogs on Meis homeobox 3