Recombinant Human MED26 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MED26 Protein [H00009441-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human MED26 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-600 of Human MED26 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDVRKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGPPRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPLPTNGISGSPESFASSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQPKASVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSPSPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MED26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
91.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MED26 GST (N-Term) Protein

  • Activator-recruited cofactor 70 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 7
  • cofactor required for Sp1 transcriptional activation, subunit 7 (70kD)
  • cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa
  • CRSP70ARC70
  • CRSP7CRSP complex subunit 7
  • mediator complex subunit 26Transcriptional coactivator CRSP70
  • mediator of RNA polymerase II transcription subunit 26

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006919-B02P
Species: Hu
Applications: ICC/IF, WB
NBP1-93707
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00006920-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-81319
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87040
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
AF5520
Species: Hu, Mu
Applications: WB
NBP2-86684
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-83187
Species: Hu
Applications: ChIP, WB
NB200-337
Species: Hu, Mu
Applications: ChIP, IP, WB (-)
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP1-84863
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
H00009441-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for MED26 Recombinant Protein (H00009441-P01) (0)

There are no publications for MED26 Recombinant Protein (H00009441-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED26 Recombinant Protein (H00009441-P01) (0)

There are no reviews for MED26 Recombinant Protein (H00009441-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED26 Recombinant Protein (H00009441-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED26 Products

Bioinformatics Tool for MED26 Recombinant Protein (H00009441-P01)

Discover related pathways, diseases and genes to MED26 Recombinant Protein (H00009441-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED26 Recombinant Protein (H00009441-P01)

Discover more about diseases related to MED26 Recombinant Protein (H00009441-P01).
 

Pathways for MED26 Recombinant Protein (H00009441-P01)

View related products by pathway.

Blogs on MED26

There are no specific blogs for MED26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SP1 Antibody
NB600-232

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MED26 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED26