MED26 Recombinant Protein Antigen

Images

 
There are currently no images for MED26 Recombinant Protein Antigen (NBP2-62629PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED26 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED26.

Source: E. coli

Amino Acid Sequence: PGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED26
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62629.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED26 Recombinant Protein Antigen

  • Activator-recruited cofactor 70 kDa component
  • Cofactor required for Sp1 transcriptional activation subunit 7
  • cofactor required for Sp1 transcriptional activation, subunit 7 (70kD)
  • cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa
  • CRSP70ARC70
  • CRSP7CRSP complex subunit 7
  • mediator complex subunit 26Transcriptional coactivator CRSP70
  • mediator of RNA polymerase II transcription subunit 26

Background

In mammalian cells, transcription is regulated in part by high molecular weight coactivating complexes that mediate signals between transcriptional activators and RNA polymerase. These complexes include CRSP (for cofactor required for Sp1 activation), which is required, in conjunction with TAFIIs, for transcriptional activation by Sp1. CRSP is ubiquitously expressed in various tissues and functions as a multimeric complex that consists of nine distinct subunits. Several members of the CRSP family share sequence similarity with multiple components of the yeast transcriptional mediator proteins, including CRSP150, which is related to yeast Rgr1, and CRSP70, which is similar to the elongation factor TFIIS. CRSP77 and CRSP150 are also related to proteins within the putative murine mediator complex, while CRSP130 and CRSP34 are largely unrelated to either murine or yeast proteins. CRSP subunits also associate with larger multimeric coactivaor complexes, including ARC/DRI, which binds directly to SREBP and nuclear hormone receptors to facilitate transcription, and with NAT, a polymerase II-interacting complex that represses activated transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006919-B02P
Species: Hu
Applications: ICC/IF, WB
NBP1-93707
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00006920-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-81319
Species: Hu
Applications: ICC/IF, WB
NBP1-87040
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-26850
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-05055
Species: Hu, Mu, Rt
Applications: WB
NB200-338
Species: Hu, Mu
Applications: IP, WB (-)
NBP1-89612
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-31639
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP1-82399
Species: Mu
Applications: WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP1-84862
Species: Hu
Applications: ICC/IF, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-62629PEP
Species: Hu
Applications: AC

Publications for MED26 Recombinant Protein Antigen (NBP2-62629PEP) (0)

There are no publications for MED26 Recombinant Protein Antigen (NBP2-62629PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED26 Recombinant Protein Antigen (NBP2-62629PEP) (0)

There are no reviews for MED26 Recombinant Protein Antigen (NBP2-62629PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED26 Recombinant Protein Antigen (NBP2-62629PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED26 Products

Array NBP2-62629PEP

Blogs on MED26

There are no specific blogs for MED26, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED26 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED26