![Western Blot: MED19 Antibody [NBP2-87792] - Host: Rabbit. Target Name: MED19. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/MED19-Antibody-Western-Blot-NBP2-87792-img0002.jpg "Western Blot: MED19 Antibody [NBP2-87792] - Host: Rabbit. Target Name: MED19. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit MED19 Antibody - BSA Free (NBP2-87792) is a polyclonal antibody validated for use in WB and ChIP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human MED19. Peptide sequence: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MED19 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MED19 |
![Chromatin Immunoprecipitation: MED19 Antibody [NBP2-87792] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.](http://images.novusbio.com/fullsize/MED19-Antibody-Chromatin-Immunoprecipitation-NBP2-87792-img0001.jpg "Chromatin Immunoprecipitation: MED19 Antibody [NBP2-87792] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.")
![Western Blot: MED19 Antibody [NBP2-87792] - Host: Rabbit. Target: MED19. Positive control (+): Rat testis (R-TE). Negative control (-): Rat kidney (R-KI). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/MED19-Antibody-Western-Blot-NBP2-87792-img0003.jpg "Western Blot: MED19 Antibody [NBP2-87792] - Host: Rabbit. Target: MED19. Positive control (+): Rat testis (R-TE). Negative control (-): Rat kidney (R-KI). Antibody concentration: 1ug/ml")
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/COMP_DCMP0_ELISA_66.jpg)
![N/A COMP/Thrombospondin-5 [HRP]](https://images.novusbio.com/images2/DATA_COMP_DCMP0_ELISA_632.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
