MED15 Antibody (4A4)

Images

 
Western Blot: MED15 Antibody (4A4) [H00051586-M02] - Western Blot analysis of PCQAP expression in NIH/3T3(Cat # L018V1 ).
Immunocytochemistry/ Immunofluorescence: MED15 Antibody (4A4) [H00051586-M02] - Analysis of monoclonal antibody to PCQAP on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: MED15 Antibody (4A4) [H00051586-M02] - Western Blot analysis of PCQAP expression in Hela NE ( Cat # L013V3 ).
Sandwich ELISA: MED15 Antibody (4A4) [H00051586-M02] - Detection limit for recombinant GST tagged MED15 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, ELISA, ICC/IF, S-ELISA
Clone
4A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MED15 Antibody (4A4) Summary

Immunogen
PCQAP (NP_056973, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSL
Specificity
PCQAP - PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MED15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Publications
Read Publications using H00051586-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MED15 Antibody (4A4)

  • ARC105Arc105
  • CAG7A
  • CTG repeat protein 7a
  • CTG7A
  • FLJ42282
  • FLJ42935
  • mediator complex subunit 15PC2 glutamine/Q-rich-associated protein
  • mediator of RNA polymerase II transcription subunit 15
  • PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein
  • PC2-glutamine-rich-associated protein
  • PCQAPDKFZp686A2214
  • Positive cofactor 2 glutamine/Q-rich-associated protein
  • positive cofactor 2, glutamine/Q-rich-associated protein
  • TIG1DKFZp762B1216
  • TIG-1TPA-inducible gene 1 protein
  • TNRC7
  • TPA inducible gene-1
  • TPA inducible protein
  • trinucleotide repeat containing 7,105-kD
  • Trinucleotide repeat-containing gene 7 protein

Background

The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00637
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-26616
Species: Hu
Applications: IP, WB
H00056475-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP2-24530
Species: Bv, Hu, Mu, Rt
Applications: Flow-IC, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
DTSP10
Species: Hu
Applications: ELISA

Publications for MED15 Antibody (H00051586-M02)(2)

Reviews for MED15 Antibody (H00051586-M02) (0)

There are no reviews for MED15 Antibody (H00051586-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for MED15 Antibody (H00051586-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED15 Products

Bioinformatics Tool for MED15 Antibody (H00051586-M02)

Discover related pathways, diseases and genes to MED15 Antibody (H00051586-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED15 Antibody (H00051586-M02)

Discover more about diseases related to MED15 Antibody (H00051586-M02).
 

Pathways for MED15 Antibody (H00051586-M02)

View related products by pathway.

PTMs for MED15 Antibody (H00051586-M02)

Learn more about PTMs related to MED15 Antibody (H00051586-M02).

Blogs on MED15.

TAZ Antibody: The Devil is in the Details
WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED15 Antibody (4A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol MED15
Entrez
OMIM
Uniprot