Recombinant Human MCM8 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MCM8 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 646-735 of Human MCM8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MCM8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00084515-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MCM8 GST (N-Term) Protein

  • C20orf154
  • chromosome 20 open reading frame 154
  • dJ967N21.5
  • DNA replication licensing factor MCM8
  • MCM8 minichromosome maintenance deficient 8
  • MGC119522
  • MGC119523
  • MGC12866
  • MGC4816
  • Minichromosome maintenance 8
  • minichromosome maintenance complex component 8
  • REC homolog
  • REC

Background

MCM8 - MCM8 minichromosome maintenance deficient 8 (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-31593
Species: Hu
Applications: WB
NBP3-05676
Species: Hu
Applications: WB
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-46403
Species: Hu
Applications: IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-86740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004176-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA
NBP1-20194
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-87382
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MCM8 Partial Recombinant Protein (H00084515-Q01)(1)

Reviews for MCM8 Partial Recombinant Protein (H00084515-Q01) (0)

There are no reviews for MCM8 Partial Recombinant Protein (H00084515-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCM8 Partial Recombinant Protein (H00084515-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MCM8 Products

Array H00084515-Q01

Bioinformatics Tool for MCM8 Partial Recombinant Protein (H00084515-Q01)

Discover related pathways, diseases and genes to MCM8 Partial Recombinant Protein (H00084515-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MCM8 Partial Recombinant Protein (H00084515-Q01)

Discover more about diseases related to MCM8 Partial Recombinant Protein (H00084515-Q01).
 

Pathways for MCM8 Partial Recombinant Protein (H00084515-Q01)

View related products by pathway.

Research Areas for MCM8 Partial Recombinant Protein (H00084515-Q01)

Find related products by research area.

Blogs on MCM8

There are no specific blogs for MCM8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MCM8 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM8