Maxi Potassium channel alpha Recombinant Protein Antigen

Images

 
There are currently no images for Maxi Potassium channel alpha Protein (NBP2-33726PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Maxi Potassium channel alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNMA1.

Source: E. coli

Amino Acid Sequence: INLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQDDDDDPDTELYLTQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNMA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Maxi Potassium channel alpha Recombinant Protein Antigen

  • bA205K10.1
  • BK channel
  • BKCA alpha subunit
  • BKCA alpha
  • BKTM
  • calcium-activated potassium channel subunit alpha-1
  • DKFZp686K1437
  • hSlo
  • K(VCA)alpha
  • KCa1.1
  • KCNMA
  • KCNMA1
  • Maxi K channel
  • Maxi Potassium channel alpha
  • MaxiK
  • MGC71881
  • potassium large conductance calcium-activated channel, subfamily M, alphamember 1
  • SAKCA
  • Slo homolog
  • SLO
  • Slo1
  • Slo-alpha
  • Slowpoke homolog
  • stretch-activated Kca channel
  • subfamily M subunit alpha-1

Background

Function: Potassium channel activated by both membrane depolarization or increase in cytosolic Ca(2+) that mediates export of K(+). It is also activated by the concentration of cytosolic Mg(2+). Its activation dampens the excitatory events that elevate the cytosolic Ca(2+) concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca(2+), caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel also contains binding sites for Ca(2+) and Mg(2+).; Defects in KCNMA1 are the cause of generalized epilepsy and paroxysmal dyskinesia (GEPD). Epilepsy is one of the most common and debilitating neurological disorders. Paroxysmal dyskinesias are neurological disorders characterized by sudden, unpredictable, disabling attacks of involuntary movement often requiring life-long treatment. The coexistence of epilepsy and paroxysmal dyskinesia in the same individual or family is an increasingly recognized phenomenon. Patients manifest absence seizures, generalized tonic-clonic seizures, paroxysmal nonkinesigenic dyskinesia, involuntary dystonic or choreiform movements. Onset is usually in childhood and patients may have seizures only, dyskinesia only, or both.; Enzyme regulation: Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation.; Subcellular location: Membrane, Multi-pass membrane protein.; Tissue specificity: Widely expressed. Except in myocytes, it is almost ubiquitously expressed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33694
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF5486
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NB300-535
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-06542
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF640
Species: Mu
Applications: IHC, WB
NBP2-56583
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-05611
Species: Rt
Applications: ELISA, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-03748
Species: Mu
Applications: IHC,  IHC-P, WB
NBP3-35469
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-05611
Species: Rt
Applications: ELISA, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB

Publications for Maxi Potassium channel alpha Protein (NBP2-33726PEP) (0)

There are no publications for Maxi Potassium channel alpha Protein (NBP2-33726PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Maxi Potassium channel alpha Protein (NBP2-33726PEP) (0)

There are no reviews for Maxi Potassium channel alpha Protein (NBP2-33726PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Maxi Potassium channel alpha Protein (NBP2-33726PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Maxi Potassium channel alpha Products

Research Areas for Maxi Potassium channel alpha Protein (NBP2-33726PEP)

Find related products by research area.

Blogs on Maxi Potassium channel alpha

There are no specific blogs for Maxi Potassium channel alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Maxi Potassium channel alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNMA1