Matriptase/ST14 Recombinant Protein Antigen

Images

 
There are currently no images for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Matriptase/ST14 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Matriptase/ST14.

Source: E. coli

Amino Acid Sequence: VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ST14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-05520.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Matriptase/ST14 Recombinant Protein Antigen

  • EC 3.4.21
  • Epithin
  • HAI
  • Matriptase
  • Membrane-type serine protease 1
  • MTSP1
  • MT-SP1EC 3.4.21.109
  • prostamin
  • PRSS14
  • Serine protease 14
  • Serine protease TADG-15
  • SNC19
  • SNC19MTSP1
  • ST14
  • suppression of tumorigenicity 14 (colon carcinoma)
  • suppression of tumorigenicity 14 (colon carcinoma, matriptase, epithin)
  • suppressor of tumorigenicity 14 protein
  • TADG15
  • TADG-15
  • TMPRSS14
  • tumor associated differentially expressed gene 15 protein
  • Tumor-associated differentially-expressed gene 15 protein

Background

ST14 is encoded by this gene is an epithelial-derived, integral membrane serine protease. This protease forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is found to be activated by sphingosine 1-phosphate. This protease has been shown to cleave and activate hepatocyte growth factor/scattering factor, and urokinase plasminogen activator, which suggest the function of this protease as an epithelial membrane activator for other proteases and latent growth factors. The expression of this protease has been associated with breast, colon, prostate, and ovarian tumors, which implicates its role in cancer invasion, and metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1048
Species: Hu
Applications: IHC, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1106
Species: Hu
Applications: IP, WB
294-HG
Species: Hu
Applications: BA
1310-SE
Species: Hu
Applications: EnzAct
NBP3-25721
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF4478
Species: Hu
Applications: IHC, WB
AF4599
Species: Hu
Applications: IHC, IP, Simple Western, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP3-05520PEP
Species: Hu
Applications: AC

Publications for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP) (0)

There are no publications for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP) (0)

There are no reviews for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Matriptase/ST14 Products

Research Areas for Matriptase/ST14 Recombinant Protein Antigen (NBP3-05520PEP)

Find related products by research area.

Blogs on Matriptase/ST14

There are no specific blogs for Matriptase/ST14, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Matriptase/ST14 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ST14