| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 7A0X1 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAT2A (P31153). MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFD |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | MAT2A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 44 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MAT2A Antibody (NBP3-15730)Find related products by research area.
|
|
MAT2A - A Protien Coding Gene The enzyme S-adenosylmethionine synthetase, or MAT, catalyzes the formation of S- adenosylmethionine (AdoMet or SAMe) from methionine and ATP. AdoMet is the principal biological source of synthesized methyl, and is found in all cells but most prominen... Read full blog post. |
|
MAT2a, MAT2b, HIF-1 alpha: Roles in Liver Cancer and DNA methylation Methionine Adenosyltransferase II alpha, also known as MAT2a, is a catalytic subunit of methionine adenosyltransferase (MAT) and essential enzyme for the catalysis of the principle biological methyl donor, S-adenosylmethionine (SAM) from methionine an... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAT2A |