MARCH6 Antibody - Azide and BSA Free

Western Blot: MARCH6 Antibody [NBP2-92293] - Western blot analysis of extracts of various cell lines, using MARCH6 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 90s.

Product Discontinued

MARCH6 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human MARCH6 (NP_005876.2). RVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCHF6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MARCH6 Antibody - Azide and BSA Free

• E3 ubiquitin-protein ligase MARCH6
• EC 6.3.2.-
• MARCH-VIDOA10
• membrane-associated ring finger (C3HC4) 6
• Membrane-associated RING finger protein 6
• Membrane-associated RING-CH protein VI
• Protein TEB-4
• RNF176KIAA0597Doa10 homolog
• TEB4RING finger protein 176

Background

MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCHF6