MAPKAPK2 Antibody (3S9N5)

Western Blot: MAPKAPK2 Antibody (3S9N5) [NBP3-33338] - Western blot analysis of various lysates, using MAPKAPK2 Rabbit mAb at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 3S9N5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAPKAPK2 Antibody (3S9N5) Summary

• Description: Novus Biologicals Rabbit MAPKAPK2 Antibody (3S9N5) (NBP3-33338) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPKAPK2 (NP_116584.2).
  
  Sequence:
  MLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: MAPKAPK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 46 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for MAPKAPK2 Antibody (3S9N5)

• EC 2.7.11
• EC 2.7.11.1
• MAP kinase-activated protein kinase 2
• MAPK-activated protein kinase 2
• MAPKAP kinase 2
• MAPKAPK2
• MAPKAPK-2
• mitogen-activated protein kinase-activated protein kinase 2
• MK2
• Rps6kc1

Background

MAPKAP Kinase 2 encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPKAPK2