MAPKAPK2 Antibody (3A7) - Azide and BSA Free

Western Blot: MAPKAPK2 Antibody (3A7) [H00009261-M10] - Analysis of MAPKAPK2 expression in PC-12 (Cat # L012V1).

Immunocytochemistry/Immunofluorescence: MAPKAPK2 Antibody (3A7) [H00009261-M10] - Analysis of monoclonal antibody to MAPKAPK2 on HeLa cell. Antibody concentration 30 ug/ml

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 3A7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAPKAPK2 Antibody (3A7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MAPKAPK2 Antibody (3A7) - Azide and BSA Free (H00009261-M10) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
• Specificity: MAPKAPK2 (3A7)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAPKAPK2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAPKAPK2 Antibody (3A7) - Azide and BSA Free

• EC 2.7.11
• EC 2.7.11.1
• MAP kinase-activated protein kinase 2
• MAPK-activated protein kinase 2
• MAPKAP kinase 2
• MAPKAPK2
• MAPKAPK-2
• mitogen-activated protein kinase-activated protein kinase 2
• MK2
• Rps6kc1

Background

This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPKAPK2
• Entrez:
  • 9261(Human)
• OMIM:
  • 602006(Human)
• Uniprot:
  • NP_116584(Human)