Recombinant Human Map17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Map17 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-114 of Human PDZK1IP1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PDZK1IP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Map17 Protein

  • 17 kDa membrane-associated protein
  • DD96
  • MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17
  • membrane-associated protein 17
  • PDZK1 interacting protein 1
  • PDZK1-interacting protein 1
  • Protein DD96
  • RP1-18D14.5
  • SPAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB300-536
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP, IF
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-59448
Species: Hu
Applications: WB
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Map17 Recombinant Protein (H00010158-P01) (0)

There are no publications for Map17 Recombinant Protein (H00010158-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Map17 Recombinant Protein (H00010158-P01) (0)

There are no reviews for Map17 Recombinant Protein (H00010158-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Map17 Recombinant Protein (H00010158-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Map17 Products

Bioinformatics Tool for Map17 Recombinant Protein (H00010158-P01)

Discover related pathways, diseases and genes to Map17 Recombinant Protein (H00010158-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Map17 Recombinant Protein (H00010158-P01)

Discover more about diseases related to Map17 Recombinant Protein (H00010158-P01).
 

Pathways for Map17 Recombinant Protein (H00010158-P01)

View related products by pathway.

PTMs for Map17 Recombinant Protein (H00010158-P01)

Learn more about PTMs related to Map17 Recombinant Protein (H00010158-P01).
 

Research Areas for Map17 Recombinant Protein (H00010158-P01)

Find related products by research area.

Blogs on Map17.

One MAP to Navigate the Oxidative Stress, Tumorigenesis and Apoptosis Pathways?
Reactive oxygen species, ROS, are beneficially involved in many signaling pathways that control development and maintain cellular homeostasis. In physiological conditions, a tightly regulated redox balance protects cells from injurious ROS activity, a...  Read full blog post.

Customers Who Bought This Also Bought

SR-BI Antibody
NB400-104
Map17 Antibody
NB400-151
PDZK1 Antibody
NB400-149

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Map17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZK1IP1