Recombinant Human Map17 GST (N-Term) Protein

SDS-Page: Recombinant Human Map17 Protein [H00010158-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human Map17 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-114 of Human PDZK1IP1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: PDZK1IP1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 38.6 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Map17 GST (N-Term) Protein

• 17 kDa membrane-associated protein
• DD96
• MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17
• membrane-associated protein 17
• PDZK1 interacting protein 1
• PDZK1-interacting protein 1
• Protein DD96
• RP1-18D14.5
• SPAP

Background

Map17, also known as small PDZK1-associated protein (SPAP) is an endogenous regulator of cellular PDZK1 levels through the regulation of PDZK1 turnover. MAP17 is only expressed at significant levels in the proximal tubular epithelial cells of the kidney, and is diffusely expressed in various carcinomas originating from kidney, colon, lung and breast. MAP17 is thought to be associates with tumor formation, and MAP17 antibodies are useful for cancer research and protein turnover studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PDZK1IP1