Map17 Recombinant Protein Antigen

Images

 
There are currently no images for Map17 Protein (NBP1-84290PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Map17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDZK1IP1.

Source: E. coli

Amino Acid Sequence: QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDZK1IP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84290.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Map17 Recombinant Protein Antigen

  • 17 kDa membrane-associated protein
  • DD96
  • MAP17epithelial protein up-regulated in carcinoma, membrane associated protein 17
  • membrane-associated protein 17
  • PDZK1 interacting protein 1
  • PDZK1-interacting protein 1
  • Protein DD96
  • RP1-18D14.5
  • SPAP

Background

Map17, also known as small PDZK1-associated protein (SPAP) is an endogenous regulator of cellular PDZK1 levels through the regulation of PDZK1 turnover. MAP17 is only expressed at significant levels in the proximal tubular epithelial cells of the kidney, and is diffusely expressed in various carcinomas originating from kidney, colon, lung and breast. MAP17 is thought to be associates with tumor formation, and MAP17 antibodies are useful for cancer research and protein turnover studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-149
Species: Bv, Hu, Mu, Rt(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC,  IHC-P, MI, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-87343
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-62583
Species: Hu
Applications: WB
AF5110
Species: Mu
Applications: IHC, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-20223
Species: Hu
Applications: ICC/IF, IP, WB
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO

Publications for Map17 Protein (NBP1-84290PEP) (0)

There are no publications for Map17 Protein (NBP1-84290PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Map17 Protein (NBP1-84290PEP) (0)

There are no reviews for Map17 Protein (NBP1-84290PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Map17 Protein (NBP1-84290PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Map17 Products

Research Areas for Map17 Protein (NBP1-84290PEP)

Find related products by research area.

Blogs on Map17.

One MAP to Navigate the Oxidative Stress, Tumorigenesis and Apoptosis Pathways?
Reactive oxygen species, ROS, are beneficially involved in many signaling pathways that control development and maintain cellular homeostasis. In physiological conditions, a tightly regulated redox balance protects cells from injurious ROS activity, a...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Map17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZK1IP1