MAGEA6 Antibody

Western Blot: MAGEA6 Antibody [NBP2-84152] - Host: Rabbit. Target Name: MAGEA6. Sample Tissue: Human 721_B lymphoblast Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

MAGEA6 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA6. Peptide sequence: PGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALRE The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGEA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MAGEA6 Antibody

• CT1.6MGC52297
• MAGE3B antigen
• MAGE3B
• MAGE-3b
• MAGE6member 6
• melanoma antigen family A, 6
• melanoma-associated antigen 6

Background

MAGEA6 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGEA6