LYPLA2 Antibody - BSA Free

Western Blot: LYPLA2 Antibody [NBP1-56653] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Immunohistochemistry-Paraffin: LYPLA2 Antibody [NBP1-56653] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, strong signal, low tissue distribution; Primary Antibody Concentration: 1:100

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

LYPLA2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to LYPLA2(lysophospholipase II) The peptide sequence was selected from the N terminal of LYPLA2. Peptide sequence MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYPLA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for LYPLA2 Antibody - BSA Free

• acyl-protein thioesterase 2
• APT2
• APT-2
• DJ886K2.4
• EC 3.1.2
• EC 3.1.2.-
• LPL-II
• LYPLA2
• lysophospholipase IIAPT-2LysoPLA II
• LysoPLA II

Background

Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for LYPLA2 Antibody (NBP1-56653). (Showing 1 - 1 of 1 FAQ).

1. Regarding WB with NBP1-56653, did it detect endogenous LYPLA2 in 293T cells or only after transfection?
   • In our validation testing, this antibody was found to detect the endogenous LYPLA2 in 293T cells

Bioinformatics

• Gene Symbol: LYPLA2
• Uniprot:
  • O95372(Human)