LRRC29 Antibody - Azide and BSA Free

Western Blot: LRRC29 Antibody [H00026231-B01P] - Analysis of LRRC29 expression in transfected 293T cell line by LRRC29 polyclonal antibody. Lane 1: LRRC29 transfected lysate(24.53 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

LRRC29 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse LRRC29 Antibody - Azide and BSA Free (H00026231-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: LRRC29 (NP_001004055.1, 1 a.a. - 223 a.a.) full-length human protein. MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL
• Specificity: LRRC29 - leucine rich repeat containing 29,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: LRRC29
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LRRC29 Antibody - Azide and BSA Free

• FBL9F-box and leucine-rich repeat protein 9FBXL9
• F-box protein FBL9
• F-box/LRR-repeat protein 9
• leucine rich repeat containing 29
• leucine-rich repeat-containing protein 29

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRRC29
• Entrez:
  • 26231(Human)
• Uniprot:
  • NP_001004055.1(Human)