LRP2BP Antibody


Western Blot: LRP2BP Antibody [NBP1-70620] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

LRP2BP Antibody Summary

Synthetic peptides corresponding to LRP2BP(LRP2 binding protein) The peptide sequence was selected from the middle region of LRP2BP. Peptide sequence RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against LRP2BP and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LRP2BP Antibody

  • DKFZp761O0113
  • FLJ44965
  • LRP2 binding protein


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IP
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LRP2BP Antibody (NBP1-70620) (0)

There are no publications for LRP2BP Antibody (NBP1-70620).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRP2BP Antibody (NBP1-70620) (0)

There are no reviews for LRP2BP Antibody (NBP1-70620). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRP2BP Antibody (NBP1-70620) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional LRP2BP Products

Bioinformatics Tool for LRP2BP Antibody (NBP1-70620)

Discover related pathways, diseases and genes to LRP2BP Antibody (NBP1-70620). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRP2BP Antibody (NBP1-70620)

Discover more about diseases related to LRP2BP Antibody (NBP1-70620).

Pathways for LRP2BP Antibody (NBP1-70620)

View related products by pathway.

Blogs on LRP2BP

There are no specific blogs for LRP2BP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LRP2BP Antibody and receive a gift card or discount.


Gene Symbol LRP2BP