LPPR3 Antibody

Immunocytochemistry/Immunofluorescence: LPPR3 Antibody [NBP2-34157] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm, cytosol & the Golgi apparatus.

Immunohistochemistry-Paraffin: LPPR3 Antibody [NBP2-34157] - Staining of human colon shows moderate nuclear positivity in glandular cells.

Product Discontinued

LPPR3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VGNFQAPPAEKPAAPAPAKDALRALTQRGHDSVYQQNKSVSTDEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLPPR3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LPPR3 Antibody

• EC 3.1.3
• EC 3.1.3.4
• Lipid Phosphate Phosphatase-Related Protein Type 3
• LPR3
• PAP-2-Like Protein 2
• PHP2
• Plasticity-Related Gene 2 Protein
• PRG2
• PRG-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLPPR3
• Uniprot:
  • Q6T4P5(Human)