LMP7/PSMB8 Antibody

Western Blot: LMP7/PSMB8 Antibody [H00005696-D01P] - Analysis of PSMB8 expression in mouse liver.

Western Blot: LMP7/PSMB8 Antibody [H00005696-D01P] - Analysis of PSMB8 expression in human kidney.

Western Blot: LMP7/PSMB8 Antibody [H00005696-D01P] - Analysis of PSMB8 expression in transfected 293T cell line by PSMB8 polyclonal antibody.Lane 1: PSMB8 transfected lysate(29.80 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

LMP7/PSMB8 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PSMB8 (NP_004150.1, 1 a.a. - 272 a.a.) full-length human protein. MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFFQSLGGDGERNVQIEMAHGTTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
• Specificity: PSMB8 - proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PSMB8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LMP7/PSMB8 Antibody

• ALDD
• beta5i
• D6S216E
• EC 3.4.25.1
• JMP
• LMP7
• LMP7MGC1491
• Low molecular mass protein 7
• low molecular weight protein 7
• Macropain subunit C13
• Multicatalytic endopeptidase complex subunit C13
• NKJO
• protease component C13
• proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalpeptidase 7)
• proteasome catalytic subunit 3i
• Proteasome Component C13
• proteasome subunit beta 5i
• proteasome subunit beta type-8
• Proteasome subunit beta-5i
• Proteasome Subunit Y2
• proteasome-related gene 7
• PSMB5i
• PSMB5iD6S216
• PSMB8
• Really interesting new gene 10 protein
• RING10
• RING10proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctionalprotease 7)
• Y2

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 3 (proteasome beta 5 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit. Two alternative transcripts encoding two isoforms have been identified; both isoforms are processed to yield the same mature subunit. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSMB8
• Entrez:
  • 5696(Human)
• Uniprot:
  • NP_004150.1(Human)