LIR-8/CD85c/LILRB5 Antibody

Images

 
Western Blot: LIR-8/CD85c/LILRB5 Antibody [NBP1-84575] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry-Paraffin: LIR-8/CD85c/LILRB5 Antibody [NBP1-84575] - Staining of human appendix shows strong cytoplasmic positivity in immune cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LIR-8/CD85c/LILRB5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LILRB5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LIR-8/CD85c/LILRB5 Protein (NBP1-84575PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIR-8/CD85c/LILRB5 Antibody

  • CD85 antigen-like family member C
  • CD85c antigen
  • CD85c
  • Leukocyte immunoglobulin-like receptor 8
  • leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains)
  • LILRB5
  • LIR8
  • LIR-8
  • LIR8CD85C
  • LIR-8leukocyte immunoglobulin-like receptor subfamily B member 5
  • member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2078
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB1806
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB30851
Species: Hu
Applications: Flow, CyTOF-ready
AF2425
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB6364
Species: Hu
Applications: Flow, CyTOF-ready
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB500-470
Species: Hu
Applications: ELISA, Flow
MAB20172
Species: Hu
Applications: WB, CyTOF-reported, Neut
NBP1-84575
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LIR-8/CD85c/LILRB5 Antibody (NBP1-84575) (0)

There are no publications for LIR-8/CD85c/LILRB5 Antibody (NBP1-84575).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIR-8/CD85c/LILRB5 Antibody (NBP1-84575) (0)

There are no reviews for LIR-8/CD85c/LILRB5 Antibody (NBP1-84575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIR-8/CD85c/LILRB5 Antibody (NBP1-84575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIR-8/CD85c/LILRB5 Products

Bioinformatics Tool for LIR-8/CD85c/LILRB5 Antibody (NBP1-84575)

Discover related pathways, diseases and genes to LIR-8/CD85c/LILRB5 Antibody (NBP1-84575). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on LIR-8/CD85c/LILRB5

There are no specific blogs for LIR-8/CD85c/LILRB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIR-8/CD85c/LILRB5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LILRB5
Entrez