LIPN Antibody

Images

 
Immunohistochemistry: LIPN Antibody [NBP1-90828] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related LIPN Primary Antibodies

Order Details


    • Catalog Number
      NBP1-90828
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

LIPN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSHAPTGSSVHNILHIKQLYHSDEFRAYDWGNDADNMKHYNQSHPPIYDLTAMKVPTAIWAGGHDVLVTPQDVARILPQIKSLHYFK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LIPN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LIPN Antibody

  • bA186O14.3
  • lipase member N
  • lipase N
  • lipase, family member N
  • lipase-like abhydrolase domain-containing protein 4
  • lipase-like, ab-hydrolase domain containing 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-79438
Species: Hu
Applications: WB
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-87326
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBP1-76243
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-47927
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45388
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
NB110-60930
Species: Hu, Mu
Applications: WB
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-90828
Species: Hu
Applications: IHC, IHC-P

Publications for LIPN Antibody (NBP1-90828) (0)

There are no publications for LIPN Antibody (NBP1-90828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIPN Antibody (NBP1-90828) (0)

There are no reviews for LIPN Antibody (NBP1-90828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for LIPN Antibody (NBP1-90828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIPN Products

LIPN NBP1-90828

Bioinformatics Tool for LIPN Antibody (NBP1-90828)

Discover related pathways, diseases and genes to LIPN Antibody (NBP1-90828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIPN Antibody (NBP1-90828)

Discover more about diseases related to LIPN Antibody (NBP1-90828).
 

Pathways for LIPN Antibody (NBP1-90828)

View related products by pathway.

Blogs on LIPN

There are no specific blogs for LIPN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIPN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPN