LIN7 Antibody

Images

 
Western Blot: LIN7 Antibody [H00008825-B01P] - Analysis of LIN7A expression in transfected 293T cell line by LIN7A polyclonal antibody. Lane 1: LIN7A transfected lysate(25.63 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

LIN7 Antibody Summary

Immunogen
LIN7A (NP_004655.1, 1 a.a. - 233 a.a.) full-length human protein. MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Specificity
Reacts with lin-7 homolog A (C. elegans).
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
LIN7A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for LIN7 Antibody

  • hLin-7
  • lin-7 homolog A (C. elegans)
  • LIN7
  • LIN-7A
  • MALS1
  • MALS-1MGC148143
  • Mammalian lin-seven protein 1
  • Tax interaction protein 33
  • TIP-33mammalian LIN-7 1
  • veli-1
  • VELI1protein lin-7 homolog A
  • vertebrate LIN7 homolog 1
  • Vertebrate lin-7 homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-53082
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02852
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-41181
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF
AF7979
Species: Hu, Mu, Rt
Applications: WB
NB100-1366
Species: Hu
Applications: WB, PEP-ELISA
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-82856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
1849-NK
Species: Hu
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-19388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, IHC, IHC-P
H00008825-B01P
Species: Hu
Applications: WB

Publications for LIN7 Antibody (H00008825-B01P) (0)

There are no publications for LIN7 Antibody (H00008825-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LIN7 Antibody (H00008825-B01P) (0)

There are no reviews for LIN7 Antibody (H00008825-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LIN7 Antibody (H00008825-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LIN7 Products

Bioinformatics Tool for LIN7 Antibody (H00008825-B01P)

Discover related pathways, diseases and genes to LIN7 Antibody (H00008825-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LIN7 Antibody (H00008825-B01P)

Discover more about diseases related to LIN7 Antibody (H00008825-B01P).
 

Pathways for LIN7 Antibody (H00008825-B01P)

View related products by pathway.

PTMs for LIN7 Antibody (H00008825-B01P)

Learn more about PTMs related to LIN7 Antibody (H00008825-B01P).

Blogs on LIN7

There are no specific blogs for LIN7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LIN7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LIN7A
Entrez
Uniprot