![Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human cerebral cortex, gastrointestinal, lymphoid tissues and testis using Anti-NFIA antibody (A) NBP1-83272 shows similar protein distribution across tissues to independent antibody NBP1-83273 (B).](http://images.novusbio.com/fullsize/LHPP-Antibody-Immunohistochemistry-Paraffin-NBP1-83272-img0021.jpg "Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human cerebral cortex, gastrointestinal, lymphoid tissues and testis using Anti-NFIA antibody (A) NBP1-83272 shows similar protein distribution across tissues to independent antibody NBP1-83273 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit LHPP Antibody - BSA Free (NBP1-83272) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LHPP Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVD |
| Predicted Species | Mouse (95%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LHPP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP1-83272 | Applications | Species |
|---|---|---|
| Linder M, Liko D, Kancherla V et al. Colitis Is Associated with Loss of the Histidine Phosphatase LHPP and Upregulation of Histidine Phosphorylation in Intestinal Epithelial Cells Biomedicines 2023-08-01 [PMID: 37626656] (Immunohistochemistry, Immunocytochemistry/ Immunofluorescence) | Immunohistochemistry, Immunocytochemistry/ Immunofluorescence |
Secondary Antibodies |
Isotype Controls |
Research Areas for LHPP Antibody (NBP1-83272)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LHPP |
![Immunocytochemistry/Immunofluorescence: LHPP Antibody [NBP1-83272] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/LHPP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83272-img0007.jpg "Immunocytochemistry/Immunofluorescence: LHPP Antibody [NBP1-83272] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human cerebral cortex shows moderate positivity in neurons and glial cells.](http://images.novusbio.com/fullsize/LHPP-Antibody-Immunohistochemistry-Paraffin-NBP1-83272-img0017.jpg "Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human cerebral cortex shows moderate positivity in neurons and glial cells.")
![Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/LHPP-Antibody-Immunohistochemistry-Paraffin-NBP1-83272-img0018.jpg "Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/LHPP-Antibody-Immunohistochemistry-Paraffin-NBP1-83272-img0019.jpg "Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human skeletal muscle shows very weak positivity in myocytes.](http://images.novusbio.com/fullsize/LHPP-Antibody-Immunohistochemistry-Paraffin-NBP1-83272-img0020.jpg "Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human skeletal muscle shows very weak positivity in myocytes.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")