LHPP Antibody

Images

 
Western Blot: LHPP Antibody [NBP1-83272] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: LHPP Antibody [NBP1-83272] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.
Immunohistochemistry-Paraffin: LHPP Antibody [NBP1-83272] - Staining of human hippocampus shows strong nuclear and cytoplasmic positivity in glial cells.
Western Blot: LHPP Antibody [NBP1-83272] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LHPP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LISLGKGRYYKETSGLMLDVGPYMKALEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LHPP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LHPP Protein (NBP1-83272PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LHPP Antibody

  • FLJ44846
  • HDHD2B
  • hLHPP
  • MGC117251
  • MGC142189
  • MGC142191
  • phospholysine phosphohistidine inorganic pyrophosphate phosphatase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59677
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83272
Species: Hu, Rt, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LHPP Antibody (NBP1-83272) (0)

There are no publications for LHPP Antibody (NBP1-83272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHPP Antibody (NBP1-83272) (0)

There are no reviews for LHPP Antibody (NBP1-83272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LHPP Antibody (NBP1-83272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LHPP Products

Bioinformatics Tool for LHPP Antibody (NBP1-83272)

Discover related pathways, diseases and genes to LHPP Antibody (NBP1-83272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHPP Antibody (NBP1-83272)

Discover more about diseases related to LHPP Antibody (NBP1-83272).
 

Pathways for LHPP Antibody (NBP1-83272)

View related products by pathway.

PTMs for LHPP Antibody (NBP1-83272)

Learn more about PTMs related to LHPP Antibody (NBP1-83272).

Blogs on LHPP

There are no specific blogs for LHPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LHPP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LHPP