Recombinant Human LGTN Protein

Images

 
SDS-Page: Recombinant Human LGTN Protein [H00001939-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human LGTN Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 485-584 of Human LGTN

Source: Wheat Germ

Amino Acid Sequence: KGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQVHHLGWLLLEEYQLPRKHIQGLEKALKPGKKK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF2D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LGTN Protein

  • eukaryotic translation initiation factor 2D
  • HCA56eIF2d
  • Hepatocellular carcinoma-associated antigen 56
  • LGTNLigatin
  • ligatin

Background

This gene encodes a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
AF2800
Species: Mu
Applications: WB, IHC, Block
H00000677-M02
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NB400-116
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-67591
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85123
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
6144-GH
Species: Hu
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83754
Species: Hu
Applications: IHC, IHC-P
H00002023-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-98539
Species: Hu
Applications: WB
H00001939-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for LGTN Partial Recombinant Protein (H00001939-Q01) (0)

There are no publications for LGTN Partial Recombinant Protein (H00001939-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LGTN Partial Recombinant Protein (H00001939-Q01) (0)

There are no reviews for LGTN Partial Recombinant Protein (H00001939-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LGTN Partial Recombinant Protein (H00001939-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for LGTN Partial Recombinant Protein (H00001939-Q01)

Discover related pathways, diseases and genes to LGTN Partial Recombinant Protein (H00001939-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LGTN Partial Recombinant Protein (H00001939-Q01)

Discover more about diseases related to LGTN Partial Recombinant Protein (H00001939-Q01).
 

Pathways for LGTN Partial Recombinant Protein (H00001939-Q01)

View related products by pathway.

Blogs on LGTN

There are no specific blogs for LGTN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

LGTN Antibody
NBP1-81308

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LGTN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2D