Lgl1 Antibody

Images

 
Western Blot: Lgl1 Antibody [NBP1-84077] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: Lgl1 Antibody [NBP1-84077] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Lgl1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDE
Specificity
Specificity of human Lgl1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LLGL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Lgl1 Protein (NBP1-84077PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Lgl1 Antibody

  • DLG4lethal giant larvae (Drosophila) homolog 1
  • HUGL
  • HUGL1
  • Hugl-1
  • Human homolog to the D-lgl gene protein
  • lethal giant larvae homolog 1 (Drosophila)
  • lethal(2) giant larvae protein homolog 1
  • LLGL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-21672
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88088
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005662-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19551
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91928
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Lgl1 Antibody (NBP1-84077) (0)

There are no publications for Lgl1 Antibody (NBP1-84077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Lgl1 Antibody (NBP1-84077) (0)

There are no reviews for Lgl1 Antibody (NBP1-84077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Lgl1 Antibody (NBP1-84077). (Showing 1 - 1 of 1 FAQ).

  1. I am interesting in using to analyze LLGL1 sub-cellular localization in my model system. The organotypic model I use is to culture canine kidney cell lines in 3D matrix - the cells form into polarized, cyst structures over time. I treat these cysts with growth factors, to monitor morphogenesis of epithelial tissue. The organoids will be fixed, in PFA, and I will be performing IF with the antibody, since there are currently no LLGL1 antibodies available that detect endogenous protein in canine cell lines. Does this application meet requirements for the Innovators Reward initiative? If our customer is eligible do they have to purchase the antibody at the full price?
    • That should be just fine for our Innovators Reward Program. As you know, the customer has to purchase the antibody at full price, and then email innovators@novusbio.com to receive the form to complete and share their data before the Innovator's Reward can be applied.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Lgl1 Antibody (NBP1-84077)

Discover related pathways, diseases and genes to Lgl1 Antibody (NBP1-84077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Lgl1 Antibody (NBP1-84077)

Discover more about diseases related to Lgl1 Antibody (NBP1-84077).
 

Pathways for Lgl1 Antibody (NBP1-84077)

View related products by pathway.

PTMs for Lgl1 Antibody (NBP1-84077)

Learn more about PTMs related to Lgl1 Antibody (NBP1-84077).

Blogs on Lgl1

There are no specific blogs for Lgl1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Lgl1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LLGL1
Entrez
Uniprot