![Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human HepG2. Antibody Dilution: 1.0ug/mlLEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells](http://images.novusbio.com/fullsize/LEPROTL1-Antibody-Western-Blot-NBP2-83143-img0004.jpg "Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human HepG2. Antibody Dilution: 1.0ug/mlLEPROTL1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit LEPROTL1 Antibody - BSA Free (NBP2-83143) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LEPROTL1. Peptide sequence: FVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LEPROTL1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/16321.jpg)
![Knockout Validated STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Knockout_Validated_21968.jpg)
![Immunocytochemistry STAT5b Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT5b_AF1584_Immunocytochemistry__Immunofluorescence_17603.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LEPROTL1 |
![Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/LEPROTL1-Antibody-Western-Blot-NBP2-83143-img0001.jpg "Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml")
![Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human Hela. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa](http://images.novusbio.com/fullsize/LEPROTL1-Antibody-Western-Blot-NBP2-83143-img0002.jpg "Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human Hela. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in HeLa")
![Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B](http://images.novusbio.com/fullsize/LEPROTL1-Antibody-Western-Blot-NBP2-83143-img0003.jpg "Western Blot: LEPROTL1 Antibody [NBP2-83143] - Host: Rabbit. Target Name: LEPROTL1. Sample Type: Human 721_B. Antibody Dilution: 1.0ug/mlLEPROTL1 is supported by BioGPS gene expression data to be expressed in 721_B")
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images2/Leptin_R_AF497_Immunohistochemistry_6850.jpg)
![Western Blot Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-41202410481130.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-immunohistochemistry-251120248493..jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Western_Blot_5176.jpg)
![Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16339.jpg)
![Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/STAT5b_AF2168_Chromatin_Immunoprecipitation_11246.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
