Home » LCORL » LCORL Antibodies » LCORL Antibody

LCORL Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: LCORL Antibody [NBP1-91618] - Human Testis lysate, concentration 1.25ug/ml.
Western Blot: LCORL Antibody [NBP1-91618] - Human Testis lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity Hu, Bv, Mu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

LCORL Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human A830039H10RIK. Peptide sequence EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCORL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against A830039H10RIK and was validated on Western blot.
Publications
Read Publication using
NBP1-91618 in the following applications:

  • WB
    1 publication

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 24278337).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LCORL Antibody

  • FLJ30696
  • LCoR-like protein
  • ligand dependent nuclear receptor corepressor-like
  • ligand-dependent nuclear receptor corepressor-like protein
  • MLR1MBLK1-related protein
  • transcription factor MLR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LCoR Antibody
NBP1-83477
Western Blot: LCoR Antibody [NBP1-83477] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: LCoR Antibody [NBP1-83477] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: LCoR Antibody [NBP1-83477] - Staining of human cervix shows strong nuclear positivity in squamous epithelial cells.
(2 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
HCAP-G Antibody
NB100-56225
HCAP-G Antibody
Species: Hu
Applications: WB, ELISA
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Western Blot: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Analysis of Mineralocorticoid Receptor.
Immunocytochemistry/Immunofluorescence: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Mineralocorticoid Receptor staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Mineralocorticoid Receptor at a dilution of 1:20-1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) [NB300-562] - Both normal and cancer biopsies of deparaffinized Human colon carcinoma tissues.
(1 Publication)
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
GDF-8/Myostatin
[Unconjugated]
788-G8/CF
1 μg/lane of Recombinant Human/Mouse/Rat GDF-8/Myostatin was resolved withSDS-PAGE under reducing (R) andnon-reducing (NR) conditions and visualized by silver staining, showing the main bands at 12 kDa and 24 kDa, respectively.
Recombinant Human/Mouse/Rat GDF-8/Myostatin (Catalog # 788-G8/CF) induces hemoglobin expression in the K562 human chronic myelogenous leukemia cell line. The ED50 for this effect is 2-10 ng/mL.
(37 Publications)
Species: Hu, Mu, Rt
LAP3 Antibody
NBP1-82847
Western Blot: LAP3 Antibody [NBP1-82847] - Analysis using Anti-LAP3 antibody NBP1-82847 (A) shows similar pattern to independent antibody NBP1-82848 (B).
Immunocytochemistry/Immunofluorescence: LAP3 Antibody [NBP1-82847] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & midbody.
Immunohistochemistry-Paraffin: LAP3 Antibody [NBP1-82847] - Staining of human kidney.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Histone H1.3
Overexpression Lysate
NBL1-11554
Western Blot: Histone H1.3 Overexpression Lysate (Adult Normal) [NBL1-11554] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for Histone H1.3.
Species: Hu
ZNF406 Antibody
NBP2-21005
Western Blot: ZNF406 Antibody [NBP2-21005] - Sample (30 ug of whole cell lysate) A: Jurkat B: Raji 5% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: ZNF406 Antibody [NBP2-21005] - SKNSH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: ZFAT protein stained by ZFAT antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.
Immunohistochemistry-Paraffin: ZNF406 Antibody [NBP2-21005] - Paraffin-embedded mouse placenta. ZFAT antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

NGFR/TNFRSF16/p75NTR A ...
MAB367
NGF R/TNFRSF16 was detected in immersion fixed canine mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed human mesenchymal stem cells using Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
NGF R/TNFRSF16 was detected in immersion fixed paraffin-embedded sections of human brain (cortex) using 25 µg/mL Mouse Anti-Human/Canine NGF R/TNFRSF16 Monoclonal Antibody (Catalog # MAB367) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
HMGA2 Antibody
[Unconjugated]
AF3184
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, MDA‑MD‑231 human breast cancer cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and P19 mouse embryonal carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse HMGA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3184) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HMGA2 at approximately 21 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Simple Western lane view shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for HMGA2 at approximately 30 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse HMGA2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3184) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(7 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC
UQCC Antibody
NBP1-90766
Western Blot: UQCC Antibody [NBP1-90766] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: UQCC Antibody [NBP1-90766] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Western Blot: UQCC Antibody [NBP1-90766] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
CXCR4 Antibody
(44716) [Unconjugated
MAB172
Jurkat human acute T cell leukemia cell line was stained with Mouse Anti-Human CXCR4 Monoclonal Antibody (Catalog # MAB172, filled histogram) or isotype control antibody (Catalog # MAB004, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). View our protocol for Staining Membrane-associated Proteins.
CXCR4 was detected in immersion fixed paraffin-embedded sections of human lymph node using 15 µg/mL Human CXCR4 Monoclonal Antibody (Catalog # MAB172) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human/Feline/Rhesus Macaque CXCL12/SDF‑1 alpha (Catalog # 350-NS) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR4 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human/Feline/Rhesus Macaque CXCL12/SDF‑1 alpha (1 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human CXCR4 Monoclonal Antibody (Catalog # MAB172). The ND50 is typically 2.5-12 µg/mL.
(5 Reviews)
(45 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NPRL3 Antibody
(4E6)
H00008131-M02
Western Blot: NPRL3 Antibody (4E6) [H00008131-M02] - C16orf35 monoclonal antibody (M02), clone 4E6. Analysis of C16orf35 expression in IMR-32.
Western Blot: NPRL3 Antibody (4E6) [H00008131-M02] - C16orf35 monoclonal antibody (M02), clone 4E6. Analysis of C16orf35 expression in rat brain.
Species: Hu, Rt
Applications: WB, ELISA
CPOX Antibody
(36B10)
NBP2-59438
Western Blot: CPOX Antibody (36B10) [NBP2-59438] - Lane 1: Recombinant protein CPOX, Lane 2: 293T cell lysates, Lane 3: HepG2 cell lysates, Lane 4: A549 cell lysates, Lane 5: Jurkat cell lysates, Lane 6: K562 cell lysates, Lane 7: LnCaP cell lysates
Immunocytochemistry/Immunofluorescence: CPOX Antibody (36B10) [NBP2-59438] - Analysis of CPOX in Hep3B cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CPOX antibody (1:100) with goat anti-mouse IgG-Alexa fluor 488 conjugate (Green).
Species: Hu
Applications: WB, ELISA, ICC/IF
Natriuretic
Peptide Receptor C An
NBP1-31365
Western Blot: Natriuretic Peptide Receptor C Antibody [NBP1-31365] - Sample (30 ug of whole cell lysate) A: Hep G2 7.5% SDS PAGE, antibody diluted at 1:10000.
Immunocytochemistry/Immunofluorescence: Natriuretic Peptide Receptor C Antibody [NBP1-31365] - A431 cells were fixed in ice-cold MeOH for 5 min. Green: NPR-C protein stained by NPR-C antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Natriuretic Peptide Receptor C Antibody [NBP1-31365] - NPR-C protein at cell membrane and cytoplasm in mouse testis diluted at 1:500.
(3 Publications)
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
ARSE GST (N-Term) Pro ...
H00000415-Q01
SDS-Page: Recombinant Human ARSE Protein [H00000415-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
CTBP2 Antibody
(OTI4D4)
NBP2-46390
Western Blot: CTBP2 Antibody (4D4) [NBP2-46390] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CTBP2.
Immunohistochemistry: CTBP2 Antibody (4D4) [NBP2-46390] - Analysis of Human bladder tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: CTBP2 Antibody (4D4) [NBP2-46390] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
SV2A Antibody
NBP1-82964
Western Blot: SV2A Antibody [NBP1-82964] - Analysis in human cerebral cortex tissue.
Immunocytochemistry/Immunofluorescence: SV2A Antibody [NBP1-82964] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SV2A Antibody [NBP1-82964] - Staining of human small intestine shows no positivity in glandular cells.
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CD117/c-kit
Antibody [Unconjugate
AF1356
Western blot shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line, and MC/9‑2 mouse mast cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for CD117/c-kit at approximately 135, 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit was detected in immersion fixed frozen sections of mouse embryo using Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(10 Reviews)
(29 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Myoglobin Antibody
(SC06-38)
NBP2-67599
Western Blot: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of Myoglobin on human skeletal muscle lysates using anti-Myoglobin antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Myoglobin Antibody (SC06-38) [NBP2-67599] - Staining Myoglobin in C2C12 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Myoglobin Antibody (SC06-38) [NBP2-67599] - Analysis of paraffin-embedded mouse skeletal muscle tissue using anti-Myoglobin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
LCORL Antibody
NBP1-91618
LCORL Antibody
Species: Hu, Bv, Mu, Rt, Ca, Eq, Gp, Rb
Applications: WB

Publications for LCORL Antibody (NBP1-91618)(1)

We have publications tested in 1 confirmed species: Bovine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Bovine
(1)
All Species

Reviews for LCORL Antibody (NBP1-91618) (0)

There are no reviews for LCORL Antibody (NBP1-91618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCORL Antibody (NBP1-91618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional LCORL Products

Bioinformatics Tool for LCORL Antibody (NBP1-91618)

Discover related pathways, diseases and genes to LCORL Antibody (NBP1-91618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCORL Antibody (NBP1-91618)

Discover more about diseases related to LCORL Antibody (NBP1-91618).

Blogs on LCORL

There are no specific blogs for LCORL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCORL Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LCORL
Uniprot