LCORL Antibody

Images

 
Western Blot: LCORL Antibody [NBP1-91618] - Human Testis lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity Hu, Bv, Mu, Rt, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LCORL Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human A830039H10RIK. Peptide sequence EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LCORL
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
Application Notes
This is a rabbit polyclonal antibody against A830039H10RIK and was validated on Western blot.
Publications
Read Publication using
NBP1-91618 in the following applications:

  • WB
    1 publication

Reactivity Notes

Bovine reactivity reported in scientific literature (PMID: 24278337).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for LCORL Antibody

  • FLJ30696
  • LCoR-like protein
  • ligand dependent nuclear receptor corepressor-like
  • ligand-dependent nuclear receptor corepressor-like protein
  • MLR1MBLK1-related protein
  • transcription factor MLR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83477
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56225
Species: Hu
Applications: WB, ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11554
Species: Hu
NBP2-21005
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-90766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
H00008131-M02
Species: Hu, Rt
Applications: WB, ELISA
NBP2-59438
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-31365
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46390
Species: Hu
Applications: WB, IHC
NBP1-82964
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91618
Species: Hu, Bv, Mu, Rt, Ca, Eq, Gp, Rb
Applications: WB

Publications for LCORL Antibody (NBP1-91618)(1)

We have publications tested in 1 confirmed species: Bovine.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Bovine
(1)
All Species

Reviews for LCORL Antibody (NBP1-91618) (0)

There are no reviews for LCORL Antibody (NBP1-91618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LCORL Antibody (NBP1-91618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LCORL Products

Bioinformatics Tool for LCORL Antibody (NBP1-91618)

Discover related pathways, diseases and genes to LCORL Antibody (NBP1-91618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LCORL Antibody (NBP1-91618)

Discover more about diseases related to LCORL Antibody (NBP1-91618).

Blogs on LCORL

There are no specific blogs for LCORL, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LCORL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LCORL
Uniprot