Latrophilin 2/LPHN2 Antibody

Immunocytochemistry/Immunofluorescence: Latrophilin 2/LPHN2 Antibody [NBP2-58704] - Staining of human cell line SH-SY5Y shows localization to plasma membrane & cell junctions. Antibody staining is shown in green.

Product Discontinued

Latrophilin 2/LPHN2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PVKPVIGGSSSEDDAIVADASSLMHSDNPGLELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQS
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPHN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Latrophilin 2/LPHN2 Antibody

• ADGRL2
• Calcium-independent alpha-latrotoxin receptor 2
• CIRL2
• CIRL-2
• CL2
• KIAA0786
• Latrophilin 2
• Latrophilin homolog 1
• latrophilin homolog 2 (cow)
• latrophilin-2
• LEC1
• LEC1LPHH1latrophilin 1
• lectomedin-1
• LPHH1
• LPHN2

Background

Latrophilin-2 is an Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splice sites. Latrophilin-2 is endoproteolytically cleaved at the end of the GPS domain, and the two subunits remain non-covantely linked as a heterodimer. Latrophilin-2 has been reported to be expressed in brain, breast, placenta, kidney, spleen, ovary, heart, and lung. ESTs have been isolated from a wide variety of tissue libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Latrophilin 2/LPHN2 Antibody (NBP2-58704)(2)

Publications using NBP2-58704

• Pederick DT, Perry-Hauser NA, Meng H et al. Context-dependent requirement of G protein coupling for Latrophilin-2 in target selection of hippocampal axons eLife 2023-03-20 [PMID: 36939320] (Immunohistochemistry, Mouse)
• Singh J, Elhabashy H, Muthukottiappan P et al. Cross-linking of the endolysosomal system reveals potential flotillin structures and cargo Nature communications 2022-10-20 [PMID: 36266287] (IP, Human)

Bioinformatics

• Gene Symbol: LPHN2