Recombinant Human Latrophilin 1/LPHN1 Protein

Images

 
There are currently no images for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AP

Order Details

Recombinant Human Latrophilin 1/LPHN1 Protein Summary

Description
An untagged recombinant protein corresponding to the amino acid sequence of (AAH19928.1) for Human Latrophilin 1/LPHN1

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC

Preparation
Method
in vitro wheat germ expression system with proprietary liposome technology
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ADGRL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Immunoaffinity Purification
Theoretical MW
20.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative
Glycerol
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Latrophilin 1/LPHN1 Protein

  • Calcium-independent alpha-latrotoxin receptor 1
  • CIRL1
  • CIRL-1
  • KIAA0821
  • Latrophilin 1
  • latrophilin-1
  • LEC2
  • LEC2CL1
  • Lectomedin-2
  • LPHN1

Background

Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77128
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC,  IHC-P, ISH
AF5825
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-30583
Species: Hu
Applications: IHC,  IHC-P
DKK300
Species: Hu
Applications: ELISA
DCP00
Species: Hu
Applications: ELISA
NBP3-45318
Species: Hu, Mu, Rt
Applications: ELISA, IHC
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DRN00B
Species: Hu
Applications: ELISA
NBP2-12913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
M6000B
Species: Mu
Applications: ELISA
350-NS
Species: Fe, Hu, RM
Applications: BA, BA

Publications for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01) (0)

There are no publications for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01) (0)

There are no reviews for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Latrophilin 1/LPHN1 Products

Research Areas for Latrophilin 1/LPHN1 Recombinant Protein (H00022859-G01)

Find related products by research area.

Blogs on Latrophilin 1/LPHN1

There are no specific blogs for Latrophilin 1/LPHN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Latrophilin 1/LPHN1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADGRL1